2025-07-02 19:18:53, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_065014390 403 bp mRNA linear VRT 07-MAY-2024 DEFINITION PREDICTED: Oncorhynchus nerka RNA binding protein fox-1 homolog 1-like (LOC135566772), partial mRNA. ACCESSION XM_065014390 VERSION XM_065014390.1 DBLINK BioProject: PRJNA1106039 KEYWORDS RefSeq. SOURCE Oncorhynchus nerka (sockeye salmon) ORGANISM Oncorhynchus nerka Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_027037897) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_034236695.1-RS_2024_05 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 05/02/2024 ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..403 /organism="Oncorhynchus nerka" /mol_type="mRNA" /isolate="Pitt River" /db_xref="taxon:8023" /chromosome="Unknown" /sex="male" /tissue_type="multiple tissues" /dev_stage="adult" /geo_loc_name="Canada: Langley BC" /collection_date="2020-06-06" /collected_by="Lawrence J. Albright" gene 1..>403 /gene="LOC135566772" /note="RNA binding protein fox-1 homolog 1-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:135566772" CDS 122..>403 /gene="LOC135566772" /codon_start=1 /product="RNA binding protein fox-1 homolog 1-like" /protein_id="XP_064870462.1" /db_xref="GeneID:135566772" /translation="
MEEKEEGKMVEQGNQEAPPPPDSRTQPYPSAQFAPPQNGLPAEFSASHPHPAPPDYTGQPPVSEHPLNMYPTSQNHSEQSGQDTSIQTVSATAT"
ORIGIN
cacacacggggaacagcgccccatccataattgatgctagctgtgggcaggcagatgctggaggcaggaggaagaagggaggaagaagggagggaaggagggagagcagctggatgtgtttatggaggagaaagaggaaggaaagatggtggagcagggtaaccaggaggcccctccccctccagactccaggactcagccgtacccctccgcccaatttgccccccctcagaacggcctgcccgctgagttcagcgcctcacaccctcaccctgcgccccccgactacacaggacagccccccgtcagcgaacaccccctaaacatgtaccccacttcacagaaccacagtgaacagagtggacaggacaccagcatacagaccgtctcagccacagccaca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]