2025-07-02 19:25:37, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_064187043 282 bp mRNA linear INV 01-APR-2024 DEFINITION Necator americanus uncharacterized protein (RB195_019270), partial mRNA. ACCESSION XM_064187043 VERSION XM_064187043.1 DBLINK BioProject: PRJNA1090461 BioSample: SAMN37070185 KEYWORDS RefSeq. SOURCE Necator americanus (New World hookworm) ORGANISM Necator americanus Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Strongyloidea; Ancylostomatidae; Bunostominae; Necator. REFERENCE 1 (bases 1 to 282) AUTHORS Ilik,V., Petrzelkova,K.J., Pardy,F., Fuh,T., Niatou-Singa,F.S., Gouil,Q., Baker,L., Ritchie,M.E., Jex,A.R., Gazzola,D., Li,H., Toshio Fujiwara,R., Zhan,B., Aroian,R.V., Pafco,B. and Schwarz,E.M. TITLE A Necator americanus chromosomal reference genome JOURNAL Unpublished REFERENCE 2 (bases 1 to 282) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (01-APR-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 282) AUTHORS Ilik,V., Petrzelkova,K.J., Pardy,F., Fuh,T., Niatou-Singa,F.S., Gouil,Q., Baker,L., Ritchie,M.E., Jex,A.R., Gazzola,D., Li,H., Toshio Fujiwara,R., Zhan,B., Aroian,R.V., Pafco,B. and Schwarz,E.M. TITLE Direct Submission JOURNAL Submitted (21-AUG-2023) Molecular Biology and Genetics, Cornell University, Biotechnology Bldg., 526 Campus Road, Ithaca, NY 14853, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_087372). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..282 /organism="Necator americanus" /mol_type="mRNA" /strain="Aroian" /host="Mesocricetus auratus" /db_xref="taxon:51031" /chromosome="II" /sex="pooled male and female" /tissue_type="Whole animal" /dev_stage="Adults" /geo_loc_name="USA: Laboratory of Raffi Aroian, Univ. Massachusetts Chan Med. School, Worcester, MA" /collection_date="2019/2021" gene <1..>282 /locus_tag="RB195_019270" /gene_synonym="Necator_chrII.g7063" /db_xref="GeneID:89242850" CDS 1..282 /locus_tag="RB195_019270" /gene_synonym="Necator_chrII.g7063" /note="NECATOR_CHRII.G7063.T1" /codon_start=1 /product="hypothetical protein" /protein_id="XP_064042924.1" /db_xref="GeneID:89242850" /translation="
MRGTVDQCHADIILAPSEHPLTDLEYADEVVIFTGSSTKLLHFVNLASKLAAAYGLRLRPDECMQMWISLRPRTGIRVDGQPIELFDEFCNLG"
ORIGIN
atgcgaggaacagtagatcagtgtcatgccgatatcattctagcaccatcagaacaccccttgaccgatctcgagtacgctgacgaagttgttatattcacgggaagcagcacgaaacttctgcattttgtcaaccttgcatcgaagctggctgcagcctatggactacgtctacgccctgatgaatgcatgcagatgtggatttctttgagacctcgaacgggaatcagggtggacggacaaccgatcgaactcttcgatgagttctgcaacctgggctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]