LOCUS       XM_063206668            1081 bp    mRNA    linear   VRT 21-FEB-2024
DEFINITION  PREDICTED: Engraulis encrasicolus putative mediator of RNA
            polymerase II transcription subunit 26 (LOC134455543), transcript
            variant X1, mRNA.
ACCESSION   XM_063206668
VERSION     XM_063206668.1
DBLINK      BioProject: PRJNA1073985
KEYWORDS    RefSeq.
SOURCE      Engraulis encrasicolus (European anchovy)
  ORGANISM  Engraulis encrasicolus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Clupei; Clupeiformes;
            Clupeoidei; Engraulidae; Engraulinae; Engraulis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_085865) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_034702125.1-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/08/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1081
                     /organism="Engraulis encrasicolus"
                     /mol_type="mRNA"
                     /isolate="BLACKSEA-1"
                     /db_xref="taxon:184585"
                     /chromosome="9"
                     /sex="female"
                     /tissue_type="muscle"
                     /dev_stage="adult"
                     /geo_loc_name="Turkey: East Black Sea Region"
                     /collection_date="2020-02-10"
     gene            1..1081
                     /gene="LOC134455543"
                     /note="putative mediator of RNA polymerase II
                     transcription subunit 26; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:134455543"
     CDS             76..846
                     /gene="LOC134455543"
                     /codon_start=1
                     /product="uncharacterized protein LOC134455543 isoform X1"
                     /protein_id="XP_063062738.1"
                     /db_xref="GeneID:134455543"
                     /translation="

MMCGANGKQLSLAVLFVAIVSYDFRLANGGIDFKPSTNVNNSVDAASTSDIDFNPSTSVSNSINYKPSSSSDPDIKGLIPQQLQTHITLVDDEQQAIKDEQQVLKGEQQVLKGEQQVLKDELQILKDELQLVKDELQLVKDKSKRPVIQIYNDDQNPHVTSKHVQQPKPSLTTQATAPPKQQTKQQDGGSIPQHGKSKTPVAQIYDDQKPHMSKHVQQTQPSLTRQSTPEQQTEQQPLTAGHKSKHQQKRQLYSLS"

ORIGIN      

acttaaaagctgcattgatgaaactgctgctatgtgactgtcaactgtgtggtggtagcaactaataacaactgaatgatgtgtggtgcaaatggaaaacagttaagcctggctgtgctttttgtagccattgtctcctatgactttaggcttgcgaatggtggcattgacttcaaaccatccacaaatgtaaacaacagcgttgatgcggcatccacgagtgacattgatttcaatccgtccacaagtgtcagcaacagtattaattacaagccatccagcagcagtgaccctgacatcaaggggcttatccctcaacagcttcaaacacacattacccttgttgatgatgaacagcaggctatcaaagatgaacagcaggttctcaaaggtgaacagcaggttctcaaaggtgaacagcaggttctcaaagatgaactgcagattctcaaagatgaactgcaactagtcaaagatgaactgcagctagtcaaagacaaatccaaacgacctgtgatccagatctacaatgatgaccagaaccctcacgttacttccaaacatgtgcaacagccaaagccatccttgacaacacaggctacagccccaccaaagcagcagaccaagcaacaagatgggggtagtattcctcaacatggcaaatccaaaacccctgtggcacaaatctatgatgaccagaagccccatatgtccaaacatgtgcaacagacacagccatccttgacaagacagtctacaccagagcagcagacagagcaacagccccttacagcagggcataagtctaaacaccagcagaagcggcagctctactctctcagctgaatctgccatccagagctggactcgatggaggtgttaaaatgggtatgttgaaacacaattttacaacacaacacaattttacattgcctactagaagatggcttcaggcagttcagcacagactgggtcaaggcctacacttgtttccatgttttagagtgagacgtctgcacacttaaattactttttttttttttagaagttttaagaagttttgatcatttaggtcttcctc

//