LOCUS       XM_062904406             900 bp    mRNA    linear   PLN 07-FEB-2024
DEFINITION  Trichoderma aggressivum f. europaeum uncharacterized protein
            (Triagg1_9447), partial mRNA.
ACCESSION   XM_062904406
VERSION     XM_062904406.1
DBLINK      BioProject: PRJNA1073605
            BioSample: SAMN38060657
KEYWORDS    RefSeq.
SOURCE      Trichoderma aggressivum f. europaeum
  ORGANISM  Trichoderma aggressivum f. europaeum
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Hypocreaceae;
            Trichoderma.
REFERENCE   1  (bases 1 to 900)
  AUTHORS   Beijen,E. and Ohm,R.A.
  TITLE     The genome sequences of three competitors of mushroom-forming fungi
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 900)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 900)
  AUTHORS   Beijen,E. and Ohm,R.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-NOV-2023) Microbiology, Utrecht University, Padualaan
            8, Utrecht 3524 CH, Netherlands
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_026946419).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..900
                     /organism="Trichoderma aggressivum f. europaeum"
                     /mol_type="mRNA"
                     /strain="CBS 100526"
                     /isolation_source="Mushroom compost"
                     /culture_collection="CBS:100526"
                     /type_material="type material of Trichoderma aggressivum
                     f. europaeum"
                     /db_xref="taxon:173218"
                     /chromosome="Unknown"
                     /geo_loc_name="Ireland"
                     /forma="europaeum"
     gene            <1..>900
                     /locus_tag="Triagg1_9447"
                     /note="proteinId:Triagg1|g9450.t1"
                     /db_xref="GeneID:87924310"
     CDS             1..900
                     /locus_tag="Triagg1_9447"
                     /note="proteinId:Triagg1|g9450.t1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_062751608.1"
                     /db_xref="GeneID:87924310"
                     /translation="

MKFNSAAIVAILAYTTLALPAPNGKMDVGKVDLVSRNGKMDVGKVDLERRNGKMDVGKVDLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKADLERRNGKMDVGKVDY"

ORIGIN      

atgaagttcaactccgctgccattgtagccatcttggcctacaccaccttggctctgccagcgccaaacggcaagatggacgtcggcaaagtcgacctcgtgagccgcaacggcaagatggatgttggaaaagtcgaccttgaacgacgcaacggcaagatggatgttggaaaagtcgaccttgaacgacgcaacggcaagatggatgttggcaaagccgaccttgaacgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggacgtcggcaaggctgatcttgaacgacgcaacggcaagatggacgtcggcaaggctgatcttgaacgacgaaatggcaagatggatgtcggcaaagccgacctcgagagacgtaacggcaagatggacgtcggcaaagccgaccttgaacgacgtaacggcaagatggacgtcggcaaggctgatcttgaacgacgcaacggcaagatggatgtcggcaaggctgaccttgaacgacgcaacggcaagatggatgtcggcaaggctgaccttgagcgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggatgtcggcaaggctgaccttgagcgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggacgtcggaaaggctgaccttgaacgacgcaacggcaagatggacgtcggaaaggctgatcttgaacgacgcaacggcaagatggacgttggcaaggtggattactag

//