2024-05-20 10:06:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_062014793 900 bp mRNA linear VRT 02-JAN-2024 DEFINITION PREDICTED: Colius striatus keratin-associated protein 10-4-like (LOC133627764), mRNA. ACCESSION XM_062014793 VERSION XM_062014793.1 DBLINK BioProject: PRJNA1057818 KEYWORDS RefSeq; includes ab initio. SOURCE Colius striatus (speckled mousebird) ORGANISM Colius striatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Coliiformes; Coliidae; Colius. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_084783) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_028858725.1-RS_2023_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/28/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 81% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..900 /organism="Colius striatus" /mol_type="mRNA" /isolate="bColStr4" /db_xref="taxon:57412" /chromosome="25" /sex="female" /tissue_type="lung" /dev_stage="adult" /country="Denmark: Copenhagen Zoo" /lat_lon="55.67256961 N 12.52133664 E" /collected_by="Mads Bertelsen" gene 1..900 /gene="LOC133627764" /note="keratin-associated protein 10-4-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:133627764" CDS 1..900 /gene="LOC133627764" /codon_start=1 /product="keratin-associated protein 10-4-like" /protein_id="XP_061870777.1" /db_xref="GeneID:133627764" /translation="
MSVCPYPCVSVCPCPCACVRVCPCVCPYPCVSVSMCVRVSMSVCLCPCVSVCPCPCACVRVCPCVCPCPCVSVCVHVRVSVPVCVRVHVCPCVSVCPCPRVSACPCVSVSVCPCPCVSVSVCVRVSMSVCLCPCVSVCPCPCACVRVCPCVCPCPCVSVCPYPCVSVSMCVRVCPCARAHVCPRVRVCPCVRVRVSVPVCVRVRVCPCPCPRVSACVRVCPCLSVCPCPCVCPCLSVSVCPCLSVCPCPCRSPRAAVPGPAPSPWRRCRKARALRRVCRAGAVRRGRAWRGAALPGGAA"
ORIGIN
atgtccgtgtgtccgtacccgtgtgtgtccgtgtgtccatgtccgtgtgcctgtgtccgtgtgtgtccgtgtgtgtgtccgtacccgtgtgtgtccgtgtccatgtgtgtccgtgtgtccatgtccgtgtgcctgtgtccatgtgtgtccgtgtgtccatgtccgtgtgcctgtgtccgtgtgtgtccgtgtgtgtgtccgtgcccgtgtgtgtccgtgtgtgtccatgtccgtgtgtccgtacccgtgtgtgtccgtgtccatgtgtgtccgtgtgtgtccgtgtgcccgtgcccacgtgtgtccgcgtgtccgtgtgtgtccgtgtccgtgtgtccgtgcccgtgtgtgtccgtgtccgtgtgtgtccgtgtgtccatgtccgtgtgcctgtgtccatgtgtgtccgtgtgtccatgtccgtgtgcctgtgtccgtgtgtgtccgtgtgtgtgtccgtgcccgtgtgtgtccgtgtgtccgtacccgtgtgtgtccgtgtccatgtgtgtccgtgtgtgtccgtgtgcccgtgcccacgtgtgtccgcgtgtccgtgtgtgtccgtgtgtccgtgtccgtgtgtccgtgcccgtgtgtgtccgtgtccgtgtgtgtccgtgtccgtgcccgcgtgtgtccgcgtgtgtccgtgtgtgcccgtgtctgtccgtgtgtccgtgtccgtgtgtgtgcccgtgtctgtccgtgtccgtgtgcccgtgtctgtccgtgtgtccgtgtccgtgtcgctccccgcgagccgccgttcccgggcctgcgccgtctccatggcgccggtgccgtaaagcgcgcgctttacgccgtgtctgtcgtgccggggccgtcaggcgcggccgcgcgtggcgcggggcggcacttccgggcggcgcggcctag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]