LOCUS       XM_061969232             969 bp    mRNA    linear   VRT 26-DEC-2023
DEFINITION  PREDICTED: Nerophis lumbriciformis keratin-associated protein
            4-3-like (LOC133612013), mRNA.
ACCESSION   XM_061969232
VERSION     XM_061969232.1
DBLINK      BioProject: PRJNA1054156
KEYWORDS    RefSeq; corrected model; includes ab initio.
SOURCE      Nerophis lumbriciformis (worm pipefish)
  ORGANISM  Nerophis lumbriciformis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei;
            Syngnathidae; Nerophis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_084557) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_033978685.1-RS_2023_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/19/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio            :: 33% of CDS bases
            internal stop codons :: corrected 2 genomic stop codon
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..969
                     /organism="Nerophis lumbriciformis"
                     /mol_type="mRNA"
                     /strain="RoL_2023-P1"
                     /db_xref="taxon:546530"
                     /sex="male"
                     /tissue_type="Whole Body Except internal Organs"
                     /dev_stage="adult"
                     /country="Portugal"
                     /collection_date="2021-06-15"
                     /linkage_group="LG10"
     gene            1..969
                     /gene="LOC133612013"
                     /note="keratin-associated protein 4-3-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:133612013"
     CDS             1..969
                     /gene="LOC133612013"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: substituted 2 bases at 2
                     genomic stop codons"
                     /codon_start=1
                     /transl_except=(pos:484..486,aa:OTHER)
                     /transl_except=(pos:814..816,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: keratin-associated protein
                     4-3-like"
                     /protein_id="XP_061825216.1"
                     /db_xref="GeneID:133612013"
                     /translation="

MLREDNLLQDKTLREDNMLRKDNMLRKDNMLRKDNLLHEDNLLKKTKRCVKTKRCVKTKRCVKTTCCVKTTCCKTHRCVETKRCVKTTCSVKTTCCKTKCCVKTTCCVKTTCCVKTTCCVKTTCCVKTCCVKTTCCIQTCCVKTTCCVKTTCCVKTTCCKTXRCVKTTCYVKTTCCVKTTCCVKTTCYVKTTCCMKTTCSVKTTCCKTKCCVKTTCCVKTTCCVKTTCCVKTTCCVKTCCVKTTCCIQTCCVKTTCCVKTTCCVKTTCCKTXRCVKTTCYVKTTCCVKTTCCVKTTCYVKTTCCMKTTCCVKTTSSKRQNVV"

ORIGIN      

atgttgcgtgaagacaacctgttgcaagacaaaacgttgcgtgaagacaacatgttgcgtaaagacaacatgttgcgtaaagacaacatgttgcgtaaagacaacctgttgcatgaagacaacttgctcaagaagacaaaacgttgcgtgaagacaaaacgttgcgtgaagacaaaacgttgcgtgaagacaacatgttgcgtgaagacaacatgttgcaagacacaccgttgcgtggagacaaaacgttgcgtgaagacaacatgtagcgtgaagacaacctgttgcaagacaaaatgttgtgtgaagacaacatgttgcgtgaagacaacatgttgcgtaaagacaacatgttgcgtaaagacaacatgttgcgtaaagacatgttgcgtaaagacaacatgttgcatacagacatgttgcgtgaagacaacatgttgcgtgaagacaacatgttgcgtgaagacaacctgttgcaagacataacgttgcgtgaagacaacatgttacgtaaagacaacatgttgcgtgaagacaacatgttgcgtgaagacaacatgttacgtaaagacaacatgttgcatgaagacaacatgtagcgtgaagacaacctgttgcaagacaaaatgttgtgtgaagacaacatgttgcgtgaagacaacatgttgcgtaaagacaacatgttgcgtaaagacaacatgttgcgtaaagacatgttgcgtaaagacaacatgttgcatacagacatgttgcgtgaagacaacatgttgcgtgaagacaacatgttgcgtgaagacaacctgttgcaagacataacgttgcgtgaagacaacatgttacgtaaagacaacatgttgcgtgaagacaacatgttgcgtgaagacaacatgttacgtaaagacaacatgttgcatgaagacaacatgttgcgtgaagacaactagctcaaaaagacaaaacgttgtgtga

//