ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-22 13:23:33, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_061086537 1371 bp mRNA linear VRT 21-NOV-2023
DEFINITION PREDICTED: Limanda limanda SH3 domain-containing kinase-binding
protein 1 (si:dkey-71d15.2), transcript variant X1, mRNA.
ACCESSION XM_061086537
VERSION XM_061086537.1
DBLINK BioProject: PRJNA1040927
KEYWORDS RefSeq.
SOURCE Limanda limanda (common dab)
ORGANISM Limanda limanda
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
Acanthomorphata; Carangaria; Pleuronectiformes; Pleuronectoidei;
Pleuronectidae; Limanda.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_083649) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_963576545.1-RS_2023_11
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.2
Annotation Method :: Gnomon; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 11/17/2023
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..1371
/organism="Limanda limanda"
/mol_type="mRNA"
/db_xref="taxon:27771"
/chromosome="14"
gene 1..1371
/gene="si:dkey-71d15.2"
/note="SH3 domain-containing kinase-binding protein 1;
Derived by automated computational analysis using gene
prediction method: Gnomon."
/db_xref="GeneID:133019940"
CDS 617..1069
/gene="si:dkey-71d15.2"
/codon_start=1
/product="SH3 domain-containing kinase-binding protein 1"
/protein_id="XP_060942520.1"
/db_xref="GeneID:133019940"
/translation="
MYQTSQTRLNLQATLMTMMEEKRKENQSEEPGASTLRENNQEASHNDSALPAAAPKPEPTPSFSSLLPQALSAVLPQGLTSDPRPSRSPHTSLNLGELQTELRDLRDQFEQMKSQHNKEIKLLMNELDEEKKIRLTLQMEIQRMKKHMSK"
misc_feature <623..>910
/gene="si:dkey-71d15.2"
/note="DNA polymerase III subunit gamma/tau; Region:
PRK12323; cl46901"
/db_xref="CDD:481241"
misc_feature <905..>1066
/gene="si:dkey-71d15.2"
/note="Possible nuclease of RNase H fold, RuvC/YqgF family
[General function prediction only]; Region: COG2433"
/db_xref="CDD:441980"
ORIGIN
tcatcacaacatgctctgaccaccacactgggttacaatggccggtgtccagttaccacagatgctgctgtatctcactggtgacactggcaaaacaagatgtagatttaaagtctctgcaggtctttctgtctttcactacacttgtattcctcatgggcagctacagctcagccctgattcctgacactgaggagtttgcctctattgcgtctgcggcggagaagctgaacgagcagatagctggtgcagatgagaggttacagtcagagcttcagactctgggaagtatacattcttaataatatagttagaatcacattattcacttgaatactattgtaactcagctcataaatacaaagagtttgtggtctggtctgtttgtgtcccatctctccttgaggtaaatttaacttctcggagctgcctctgacacacacacacacacacaagaacacatagcagaggattctcaccctgtatttaatattaatttgactttacactagaataaattgtttctgacctaaaggccatttttaagaatttctttgggaagcaccaaactctgggatatttgttttatatatttagagtagacaaagcactttagatgtatcagacgtctcaaactagactcaatttacaggcaacactcatgacaatgatggaggagaaaagaaaagaaaaccagagtgaagaaccgggtgcttcaacgctaagagaaaacaatcaggaagcaagtcacaatgactctgccctgccggcagcggcaccaaaacctgagcccaccccgtccttctcctctctgttaccacaggctctctctgctgtgctgccccagggcctcacatccgacccccggccgagcagaagtccacacacgtcactgaacctgggggagctgcagacggagctgagggacctgagggaccagtttgagcagatgaagagtcagcacaacaaagaaatcaaactgctgatgaacgagctggatgaggagaaaaagatccgcttgactttacagatggagattcagcgtatgaagaagcacatgtctaaatgactgaaatcaacatcagagacatgagatcctgattcgatgcaaagaaccatgtttaaaaatcctgttgtgcacatatctgataaataatatttttctatgtttgatttaaaaaaaaaaaaatcatcattgctcttttttgaggaataaaacgtataaatattatatacacatatttcatataacattttatttactttttgtgagactgctgaatggccaaaaggactgaatatttttgtttttgtttattaaaaattctcatttacacaaataaatatgtcgttggaagcaacgtgaaatgt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]