2025-08-29 05:34:43, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_060004966 1244 bp mRNA linear MAM 28-OCT-2024 DEFINITION PREDICTED: Delphinus delphis Meis homeobox 2 (MEIS2), transcript variant X5, mRNA. ACCESSION XM_060004966 VERSION XM_060004966.1 DBLINK BioProject: PRJNA1022093 KEYWORDS RefSeq. SOURCE Delphinus delphis (saddleback dolphin) ORGANISM Delphinus delphis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha; Cetacea; Odontoceti; Delphinidae; Delphinus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_082684) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_949987515.2-RS_2024_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/25/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1244 /organism="Delphinus delphis" /mol_type="mRNA" /db_xref="taxon:9728" /chromosome="2" gene 1..1244 /gene="MEIS2" /note="Meis homeobox 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:132420490" CDS 127..1068 /gene="MEIS2" /codon_start=1 /product="homeobox protein Meis2 isoform X5" /protein_id="XP_059860949.1" /db_xref="GeneID:132420490" /translation="
MALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM"
misc_feature 190..444 /gene="MEIS2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:465140" misc_feature order(706..708,835..837,844..849,856..858) /gene="MEIS2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 745..861 /gene="MEIS2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" ORIGIN
tgaaccacgggccgccgctccacgccacgcagcactacggcgcgcacgccccgcaccccaatgtcatgccggccagcatgggatccgctgtcaacgacgccttgaagcgggacaaggacgcgatctatggctctggtctttgagaagtgcgagctggcgacctgcactccccgggaacccggagtggccggcggagacgtctgttcctccgactccttcaacgaggacatcgcggtcttcgccaagcaggttcgcgccgaaaagccacttttttcctcaaatccagagctggacaatttgatgatacaagcaatacaagtactaaggtttcatcttttggagttagaaaaggtccacgaactgtgtgataacttctgccaccggtacattagctgtttgaaggggaaaatgcccatagacctcgtcattgatgaaagagatggcagctccaagtcagatcacgaagaactttcaggctcctccacaaatctcgctgaccataatcctgcatcttggcgagaccacgatgatgcaacttccacccactcagcaggcaccccagggccctccagtgggggccatgcatcccagagtggagacaacagcagtgaacaaggggatggtttagacaacagtgtagcttcacctggcacaggtgacgatgatgatccagacaaggacaaaaaacgccagaagaaaagaggcattttccccaaagtagcaacaaatatcatgagagcatggctcttccagcatctcacacatccgtacccttccgaagagcagaagaaacagttagctcaagacacaggacttacaattctccaagtaaacaactggtttattaatgccagaagaagaatagtacagcccatgattgaccagtcaaatcgagcaggttttcttcttgatccttcagtgagccaaggagcagcgtatagtccagagggtcagcccatggggagctttgtgttggatggtcagcaacacatgggaatccggcctgcaggacctatgagtggaatgggcatgaatatgggcatggatgggcaatggcactacatgtaaccttcaccatgtaaagcaatcgcaaagccagggggaagtttgcagagcatgccaggggagtacgtttctcagggtggtcctatgggaatgagtatgggacagccaagttacactcctccccagatgaccccacaccctactcagttaagacatggacccccaatgcattcatattt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]