LOCUS       XM_059744892             444 bp    mRNA    linear   PLN 20-OCT-2023
DEFINITION  Aspergillus niger hypothetical protein (An16g00820), partial mRNA.
ACCESSION   XM_059744892
VERSION     XM_059744892.1
DBLINK      BioProject: PRJNA19263
            BioSample: SAMEA3283178
KEYWORDS    RefSeq.
SOURCE      Aspergillus niger
  ORGANISM  Aspergillus niger
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus; Aspergillus subgen. Circumdati.
REFERENCE   1  (bases 1 to 444)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-OCT-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NT_166531).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..444
                     /organism="Aspergillus niger"
                     /mol_type="mRNA"
                     /db_xref="taxon:5061"
                     /chromosome="V"
                     /map="unlocalized"
                     /clone="An16"
     gene            <1..>444
                     /locus_tag="An16g00820"
                     /db_xref="GeneID:84593311"
     CDS             1..444
                     /locus_tag="An16g00820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_059604744.1"
                     /db_xref="GeneID:84593311"
                     /db_xref="GOA:A2R6Q3"
                     /db_xref="UniProtKB/TrEMBL:A2R6Q3"
                     /translation="

MTNTISAWVVLPRHAELYPKREGLASGRGRQPYRQEIHLAPDWVALSQKASERAIAEPSAAVNADHPGVPSAARVLPIALRRNQLKKATLPHSQSGMSDCNTTPGECEPRLHHYHAHKSHSLFVRYCIPCTDLVYHLILSAARVRFL"

ORIGIN      

atgacgaacacaatcagtgcgtgggttgttttgcccaggcacgcggagttgtatcccaagagagaaggtctggccagtggccgcggccgccagccttacaggcaggagatacatctagctcctgattgggttgccttgagccagaaggcgtccgagcgagcgatagcagaaccttcagctgcggtcaacgccgatcaccctggtgtcccgtcggctgccagagttttgccgatcgcgctgcgcagaaatcagttgaaaaaagcaactcttccccacagtcaatctgggatgagcgactgcaataccactccgggggagtgtgagccgaggctgcatcattaccatgctcataagtctcattctttgttcgttcggtattgcatcccttgcaccgacctggtgtaccatctgattttgagtgcagcaagggtaaggttcttatga

//