2024-04-29 08:35:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_059282026 757 bp mRNA linear ROD 31-AUG-2023 DEFINITION PREDICTED: Peromyscus eremicus cysteine-rich secretory protein 1-like (LOC131926522), mRNA. ACCESSION XM_059282026 VERSION XM_059282026.1 DBLINK BioProject: PRJNA1009129 KEYWORDS RefSeq. SOURCE Peromyscus eremicus (cactus mouse) ORGANISM Peromyscus eremicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Neotominae; Peromyscus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081432) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_949786415.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/26/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..757 /organism="Peromyscus eremicus" /mol_type="mRNA" /db_xref="taxon:42410" /chromosome="16_21" gene 1..757 /gene="LOC131926522" /note="cysteine-rich secretory protein 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:131926522" CDS 1..735 /gene="LOC131926522" /codon_start=1 /product="cysteine-rich secretory protein 1-like" /protein_id="XP_059138009.1" /db_xref="GeneID:131926522" /translation="
MTLFPLLLFLTAVLPPSLLQDGYENENLENLSTTRKSVQEEIVNKHNQLRRMVSPPGSDLLKMQWSDDARVNAQRWASQCTYKHSPPETRTTKIRCGENIFMSSHPASWSRAIQRWYDEVNDFSFGSGPNKPDAVVGHYTQVVWNTSFQVACGVAECPDQSLKFFYVCHYCPPGNFVGRQYVPYTVGEPCALCPDHCDDGLCTNSCEYEDHYSNCADLKASVTCDYPMVKQNCNATCKCEGKIH"
polyA_site 757 /gene="LOC131926522" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
atgacattatttccactgttgttgttcctgactgctgtgttacccccatcccttcttcaagatggctatgagaatgaaaatcttgagaatttgtcaaccactagaaagtcagtccaagaagagattgtgaacaagcacaaccaactgagaagaatggtttctccacctggtagtgacttactaaagatgcaatggagcgatgatgcccgagtgaatgcgcagagatgggcaagccagtgcacttataaacacagtcctccagaaaccaggaccaccaagataagatgtggtgagaatatcttcatgtcaagtcacccagcatcatggtctcgtgcaatccaaaggtggtatgatgaagtcaatgatttcagttttggttcaggtccaaataaacctgatgcagtagttggacattatactcaggttgtttggaatacatctttccaagttgcatgtggagttgctgagtgccctgaccagtcattgaaattcttttatgtttgtcactattgtcctcctggtaattttgtaggaaggcaatacgttccttacacagtgggagaaccttgtgccctttgtcctgatcactgtgacgatggactatgcacaaatagttgtgaatatgaagatcactattctaactgtgcggatttgaaggcttcagtaacctgtgactatccaatggttaaacaaaactgtaatgctacatgcaaatgtgaaggcaaaattcattaaacatccagtacaaatgaacagg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]