GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 08:18:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_058236510             432 bp    mRNA    linear   PLN 19-JUL-2023
DEFINITION  PREDICTED: Magnolia sinica plasma membrane ATPase 2-like
            (LOC131238927), mRNA.
ACCESSION   XM_058236510
VERSION     XM_058236510.1
DBLINK      BioProject: PRJNA994101
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Magnolia sinica
  ORGANISM  Magnolia sinica
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Magnoliidae; Magnoliales;
            Magnoliaceae; Magnolia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_080575) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_029962835.1-RS_2023_07
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 07/13/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..432
                     /organism="Magnolia sinica"
                     /mol_type="mRNA"
                     /isolate="HGM2019"
                     /db_xref="taxon:86752"
                     /chromosome="3"
                     /tissue_type="leaf"
                     /country="China: Yunnan, Kunming"
     gene            1..432
                     /gene="LOC131238927"
                     /note="plasma membrane ATPase 2-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131238927"
     CDS             1..432
                     /gene="LOC131238927"
                     /codon_start=1
                     /product="plasma membrane ATPase 2-like"
                     /protein_id="XP_058092493.1"
                     /db_xref="GeneID:131238927"
                     /translation="
METIAGDQLAIAKETEHWLGMGTNLYPSSSLLGDNKDELVSALPVDELIEKADGFARVLPGDGVNDAPALKKANIGIAMADATDAARSASDIVLIEPGLSIGILHVPLTCSTFEFTYHDMDLFPGSIMTISKDRVKPSQLETQ"
     misc_feature    <10..420
                     /gene="LOC131238927"
                     /note="plasma-membrane proton-efflux P-type ATPase;
                     Region: ATPase-IIIA_H; TIGR01647"
                     /db_xref="CDD:273731"
ORIGIN      
atggaaaccattgcaggtgatcaattggcaattgctaaggaaaccgagcattggttgggaatgggtacaaacttgtacccatcttcatctcttctgggggacaacaaggatgaattagtttcggctctacctgtggatgaactaattgagaaagctgatggttttgctagggtgcttcctggtgatggggtcaatgatgcacctgcattaaagaaagcaaacataggaattgcaatggcagatgcaacagatgctgctcgaagtgcttctgacatagttctaatagagcctggattgagtatagggattttgcatgtgccactgacctgttccacttttgaatttacgtaccatgacatggatctatttccaggtagtatcatgacaatctccaaggacagagtcaagccttctcagctggaaactcagtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]