LOCUS       XM_057684855             531 bp    mRNA    linear   PLN 27-JUN-2023
DEFINITION  PREDICTED: Amaranthus tricolor stigma-specific STIG1-like protein 4
            (LOC130818696), mRNA.
ACCESSION   XM_057684855
VERSION     XM_057684855.1
DBLINK      BioProject: PRJNA986068
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Amaranthus tricolor
  ORGANISM  Amaranthus tricolor
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_080053) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_026212465.1-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/23/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..531
                     /organism="Amaranthus tricolor"
                     /mol_type="mRNA"
                     /cultivar="Red"
                     /isolate="AtriRed21"
                     /db_xref="taxon:29722"
                     /chromosome="7"
                     /tissue_type="leaf"
                     /country="China: Shenzhen"
     gene            1..531
                     /gene="LOC130818696"
                     /note="stigma-specific STIG1-like protein 4; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:130818696"
     CDS             1..531
                     /gene="LOC130818696"
                     /codon_start=1
                     /product="stigma-specific STIG1-like protein 4"
                     /protein_id="XP_057540838.1"
                     /db_xref="GeneID:130818696"
                     /translation="

MKQIACTIYLFLVTIIAQVDAEFNSIESGLNITKNSTSSPWLKRVFNPRAQAQGCWNRPWICSFGQVPPRRLCCMNRCVEIISDPLNCGFCGIRCPFTWQCCNGLCMNVNINPFHCGKCWNRCAIGRPCVFGLCGYAQPFPPFPFPPTLPGPPFPFPFPLPSPPGSPTTQKKLKKE"

     misc_feature    70..411
                     /gene="LOC130818696"
                     /note="Stigma-specific protein, Stig1; Region: Stig1;
                     pfam04885"
                     /db_xref="CDD:428174"
ORIGIN      

atgaagcagatagcttgtactatttatctatttttagtaacaataatagcacaagtagatgcagaatttaatagtattgaatcaggtttaaacattaccaaaaactctacgtcttctccatggcttaaacgggtttttaacccacgagctcaagcgcaaggatgttggaataggccttggatttgttcgttcgggcaagttcctcctcgaagattatgttgtatgaatcgttgtgttgagatcatatcggatcctctaaattgcggtttttgtggcataagatgcccatttacatggcaatgttgtaatggtttatgtatgaatgtaaacattaatccttttcattgtggtaaatgttggaataggtgtgcaataggaagaccatgtgtttttgggttgtgtggttatgctcaaccctttcctccatttcctttcccaccaactttgcctggcccacctttccctttccctttcccattaccttcccctcctggatctccaactactcaaaaaaaattgaagaaggaatga

//