GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-17 11:46:40, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_057162346             906 bp    mRNA    linear   PLN 09-JUN-2023
DEFINITION  Penicillium verhagenii uncharacterized protein (N7466_002949),
            partial mRNA.
ACCESSION   XM_057162346
VERSION     XM_057162346.1
DBLINK      BioProject: PRJNA973687
            BioSample: SAMN30185379
KEYWORDS    RefSeq.
SOURCE      Penicillium verhagenii
  ORGANISM  Penicillium verhagenii
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Penicillium.
REFERENCE   1  (bases 1 to 906)
  AUTHORS   Petersen,C., Sorensen,T., Nielsen,M.R., Sondergaard,T.E.,
            Sorensen,J.L., Fitzpatrick,D.A., Frisvad,J.C. and Nielsen,K.L.
  TITLE     Comparative genomic study of the Penicillium genus elucidates a
            diverse pangenome and 15 lateral gene transfer events
  JOURNAL   IMA Fungus 14 (1), 3 (2023)
   PUBMED   36726175
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 906)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUN-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 906)
  AUTHORS   Petersen,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-2023) Department of Chemistry and Bioscience,
            Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland
            9220, Denmark
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_026643167).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..906
                     /organism="Penicillium verhagenii"
                     /mol_type="mRNA"
                     /strain="IBT 33310"
                     /culture_collection="IBT:33310"
                     /db_xref="taxon:1562060"
                     /chromosome="Unknown"
     gene            <1..>906
                     /locus_tag="N7466_002949"
                     /db_xref="GeneID:81814114"
     CDS             1..906
                     /locus_tag="N7466_002949"
                     /note="C2H2-type zinc finger; Zinc-finger double-stranded
                     RNA-binding; Zinc-finger of C2H2 type"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_057025631.1"
                     /db_xref="GeneID:81814114"
                     /translation="
MACTCGRTFASEKALQQHISDLFKCSFCGTVFAHPGRTNTNPLDTIDPKRAPTPPTDMKPLAITRNSVPDLSPVSHASPSVARNPVPNLSPVSHASPSVARNPVPDLSPVSHASPSVARNPVPNLSPVSHASPSVARRSSGVGSRSFISDDALTYICYDCDRQFASQSALDSHLLYSSAHRSIFYCDECDREFASQSALDSHLLYSSAHRPIFYCDECDREFVSQPALDSHLLYSSAHRPMFYCDECDREFASQPALDGHLFYSSAHRPLTFNCFPCNRSFVNQEALSSHLRNYAAHRSNQ"
     misc_feature    139..>420
                     /locus_tag="N7466_002949"
                     /note="envelope glycoprotein C; Provisional; Region:
                     PHA03269"
                     /db_xref="CDD:165527"
     misc_feature    469..540
                     /locus_tag="N7466_002949"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275371"
     misc_feature    550..630
                     /locus_tag="N7466_002949"
                     /note="Zinc-finger double-stranded RNA-binding; Region:
                     zf-C2H2_jaz; pfam12171"
                     /db_xref="CDD:432381"
     misc_feature    556..627
                     /locus_tag="N7466_002949"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(571..573,577..579,583..585,589..594,601..606,
                     622..624,658..660,664..666,676..681,688..693,700..702,
                     745..747,751..753,757..759,763..768,775..780)
                     /locus_tag="N7466_002949"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    643..705
                     /locus_tag="N7466_002949"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    730..783
                     /locus_tag="N7466_002949"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    820..873
                     /locus_tag="N7466_002949"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275371"
ORIGIN      
atggcgtgtacttgcggtcgaacttttgcatccgaaaaggcacttcagcagcacatttcggacctattcaaatgtagcttctgtggtacggtgtttgcccatccggggcgaactaataccaatcctttggatactattgatcctaaacgagctcctacacctcccaccgatatgaagcctttggccattacaagaaactcagtccccgatctctcacccgtcagtcatgcatctccgagtgttgcaagaaatccagtccccaatctctcacccgtcagtcatgcatctccgagtgttgcaagaaacccagtccccgatctctcacccgtcagtcatgcatctccgagtgttgcaagaaatccagtccccaatctctcacccgtcagtcatgcatctccgagtgttgcaagacgttcaagtggtgtcggcagccgctcatttatcagcgatgatgcccttacttatatctgctatgactgtgatagacagtttgcgagccaatctgccctggacagccatctgctctactcttcggcccataggtcaatattctactgtgatgagtgcgacagagagtttgcgagccaatctgccctggacagccatctgctctactcttcggcccataggccaatattctactgtgatgagtgcgacagagagtttgtaagccaacctgccctggatagccatttgctatactcttcagcccacaggccgatgttttattgtgatgagtgcgaccgagagtttgcaagccagcctgctctggatggccacttgttctattcttcggcccacaggccgctgacatttaattgctttccctgcaatcgaagtttcgtcaaccaggaagcattgagttcccatctgcgcaattatgcggctcataggtcaaatcagtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]