LOCUS       XM_056638902             243 bp    mRNA    linear   PLN 06-JUN-2023
DEFINITION  Penicillium cosmopolitanum uncharacterized protein (N7509_014265),
            partial mRNA.
ACCESSION   XM_056638902
VERSION     XM_056638902.1
DBLINK      BioProject: PRJNA973687
            BioSample: SAMN30185324
KEYWORDS    RefSeq.
SOURCE      Penicillium cosmopolitanum
  ORGANISM  Penicillium cosmopolitanum
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Penicillium.
REFERENCE   1  (bases 1 to 243)
  AUTHORS   Petersen,C., Sorensen,T., Nielsen,M.R., Sondergaard,T.E.,
            Sorensen,J.L., Fitzpatrick,D.A., Frisvad,J.C. and Nielsen,K.L.
  TITLE     Comparative genomic study of the Penicillium genus elucidates a
            diverse pangenome and 15 lateral gene transfer events
  JOURNAL   IMA Fungus 14 (1), 3 (2023)
   PUBMED   36726175
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 243)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAY-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 243)
  AUTHORS   Petersen,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2022) Department of Chemistry and Bioscience,
            Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland
            9220, Denmark
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_026622683).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..243
                     /organism="Penicillium cosmopolitanum"
                     /mol_type="mRNA"
                     /strain="IBT 29677"
                     /culture_collection="IBT:29677"
                     /db_xref="taxon:1131564"
                     /chromosome="Unknown"
     gene            <1..>243
                     /locus_tag="N7509_014265"
                     /db_xref="GeneID:81377882"
     CDS             1..243
                     /locus_tag="N7509_014265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_056480891.1"
                     /db_xref="GeneID:81377882"
                     /translation="

MKGQADISSQIGENHPDCIGTMIELAECYEKQEKFDDGIAMCDQIIEGLRRISYSEHPLERKTQQQKDRLIKDGDAKKAQ"

ORIGIN      

atgaaggggcaagcagacatttcatctcaaataggcgagaaccaccccgactgcatcggtacaatgatagagcttgcagagtgctatgagaagcaggagaaatttgatgacggtatcgcaatgtgtgatcagatcatcgaaggactgcgcaggatcagctactcggaacatccattggaacgaaaaacacagcaacagaaagacagattgatcaaagatggtgatgcaaagaaggctcagtaa

//