2025-07-01 05:10:57, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_056124937 1606 bp mRNA linear MAM 09-OCT-2023 DEFINITION PREDICTED: Sorex fumeus Meis homeobox 1 (MEIS1), transcript variant X1, mRNA. ACCESSION XM_056124937 VERSION XM_056124937.1 DBLINK BioProject: PRJNA972655 KEYWORDS RefSeq. SOURCE Sorex fumeus (smoky shrew) ORGANISM Sorex fumeus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Eulipotyphla; Soricidae; Soricinae; Sorex. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_026606063) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_029834395.1-RS_2023_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/04/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1606 /organism="Sorex fumeus" /mol_type="mRNA" /db_xref="taxon:62283" /chromosome="Unknown" gene 1..1606 /gene="MEIS1" /note="Meis homeobox 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:130033301" CDS 258..1430 /gene="MEIS1" /codon_start=1 /product="homeobox protein Meis1 isoform X1" /protein_id="XP_055980912.1" /db_xref="GeneID:130033301" /translation="
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM"
misc_feature 579..833 /gene="MEIS1" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:465140" misc_feature order(1089..1091,1218..1220,1227..1232,1239..1241) /gene="MEIS1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1128..1244 /gene="MEIS1" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" ORIGIN
tttttttttttttttttgcccccgctgctgtcttggaaacggagcgcttttatgctcattgactcgggctctttgcttcaggtcccgtagaccgaagatctgggaccaggagctcacgttgctggaaacgttaagggatttttcgtcgtgcttaaaaaaatttttttttccgggggagtttgcgtatttgttccttttcacactggccttaaagaggatatattagaagttgaagtaggaagggagcagggaggccgatggcgcaaaggtacgacgatctaccccattatgggggcatggacggagtaggcatcccctccacgatgtatggggacccgcatgccgccaggtccatgcagccagtccaccacctgaaccacgggcctcctctgcactcgcatcagtacccgcacacagctcacaccaacgccatggcccccagcatgggttcctccgtcaatgacgctttaaagagagataaagatgccatttatggacaccccctcttccctctcttagcactgatttttgagaaatgtgaattagctacttgtaccccccgcgagccgggggtggcgggcggggacgtctgctcgtcagagtcattcaatgaagatatagccgtgttcgccaaacagattcgagccgaaaaacctctattttcttctaatccagaactggataacttgatgattcaagccatacaagtattaaggttccatctgttggaattagagaaggtacacgaattatgtgacaatttctgccaccggtatattagctgtttgaaagggaaaatgcctattgatttggtgatagacgatagagaaggaggatcaaaatcagacagtgaagatataacaagatcagcaaatctaactgaccagccctcttggaaccgagatcacgatgacacggcatcgacccgttcggggggaaccccaggcccttccagtggcggccacacatcacacagcggggataacagcagtgaacaaggtgatggcttggacaacagtgtagcttcccccagcacaggtgacgatgatgatccagataaggacaaaaagcgtcacaaaaagcgtggcatctttcccaaagtagccacaaatatcatgagggcgtggctgttccagcatctaacacacccttacccttctgaagaacagaagaagcagttggcacaagacacgggactcaccatccttcaagtgaacaattggtttattaatgcccggagaagaatagtgcagcccatgatagaccagtccaaccgagcagtaagtcaaggaacaccttataaccccgatggacagccaatgggaggtttcgtaatggatggtcaacaacacatgggaatcagggcaccaggacctatgagtggaatgggcatgaatatgggcatggaggggcagtggcactacatgtaaccttcatctagttaaccaatcgcaaagcaagggggaaggctgcaaagtatgccaggggagtatgtagcccggggtggtccaatgggtgtgagtatgggacagccaagttatacccagccccagatgcccccccatcctgctcagctgcgtcatgggccccccatgcatacgtacat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]