LOCUS       XM_056124937            1606 bp    mRNA    linear   MAM 09-OCT-2023
DEFINITION  PREDICTED: Sorex fumeus Meis homeobox 1 (MEIS1), transcript variant
            X1, mRNA.
ACCESSION   XM_056124937
VERSION     XM_056124937.1
DBLINK      BioProject: PRJNA972655
KEYWORDS    RefSeq.
SOURCE      Sorex fumeus (smoky shrew)
  ORGANISM  Sorex fumeus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Eulipotyphla; Soricidae;
            Soricinae; Sorex.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_026606063) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_029834395.1-RS_2023_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/04/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1606
                     /organism="Sorex fumeus"
                     /mol_type="mRNA"
                     /db_xref="taxon:62283"
                     /chromosome="Unknown"
     gene            1..1606
                     /gene="MEIS1"
                     /note="Meis homeobox 1; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 13 Proteins"
                     /db_xref="GeneID:130033301"
     CDS             258..1430
                     /gene="MEIS1"
                     /codon_start=1
                     /product="homeobox protein Meis1 isoform X1"
                     /protein_id="XP_055980912.1"
                     /db_xref="GeneID:130033301"
                     /translation="

MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM"

     misc_feature    579..833
                     /gene="MEIS1"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    order(1089..1091,1218..1220,1227..1232,1239..1241)
                     /gene="MEIS1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    1128..1244
                     /gene="MEIS1"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      

tttttttttttttttttgcccccgctgctgtcttggaaacggagcgcttttatgctcattgactcgggctctttgcttcaggtcccgtagaccgaagatctgggaccaggagctcacgttgctggaaacgttaagggatttttcgtcgtgcttaaaaaaatttttttttccgggggagtttgcgtatttgttccttttcacactggccttaaagaggatatattagaagttgaagtaggaagggagcagggaggccgatggcgcaaaggtacgacgatctaccccattatgggggcatggacggagtaggcatcccctccacgatgtatggggacccgcatgccgccaggtccatgcagccagtccaccacctgaaccacgggcctcctctgcactcgcatcagtacccgcacacagctcacaccaacgccatggcccccagcatgggttcctccgtcaatgacgctttaaagagagataaagatgccatttatggacaccccctcttccctctcttagcactgatttttgagaaatgtgaattagctacttgtaccccccgcgagccgggggtggcgggcggggacgtctgctcgtcagagtcattcaatgaagatatagccgtgttcgccaaacagattcgagccgaaaaacctctattttcttctaatccagaactggataacttgatgattcaagccatacaagtattaaggttccatctgttggaattagagaaggtacacgaattatgtgacaatttctgccaccggtatattagctgtttgaaagggaaaatgcctattgatttggtgatagacgatagagaaggaggatcaaaatcagacagtgaagatataacaagatcagcaaatctaactgaccagccctcttggaaccgagatcacgatgacacggcatcgacccgttcggggggaaccccaggcccttccagtggcggccacacatcacacagcggggataacagcagtgaacaaggtgatggcttggacaacagtgtagcttcccccagcacaggtgacgatgatgatccagataaggacaaaaagcgtcacaaaaagcgtggcatctttcccaaagtagccacaaatatcatgagggcgtggctgttccagcatctaacacacccttacccttctgaagaacagaagaagcagttggcacaagacacgggactcaccatccttcaagtgaacaattggtttattaatgcccggagaagaatagtgcagcccatgatagaccagtccaaccgagcagtaagtcaaggaacaccttataaccccgatggacagccaatgggaggtttcgtaatggatggtcaacaacacatgggaatcagggcaccaggacctatgagtggaatgggcatgaatatgggcatggaggggcagtggcactacatgtaaccttcatctagttaaccaatcgcaaagcaagggggaaggctgcaaagtatgccaggggagtatgtagcccggggtggtccaatgggtgtgagtatgggacagccaagttatacccagccccagatgcccccccatcctgctcagctgcgtcatgggccccccatgcatacgtacat

//