GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-03 05:13:07, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_056115171             755 bp    mRNA    linear   MAM 09-OCT-2023
DEFINITION  PREDICTED: Sorex fumeus claudin 7 (CLDN7), mRNA.
ACCESSION   XM_056115171
VERSION     XM_056115171.1
DBLINK      BioProject: PRJNA972655
KEYWORDS    RefSeq.
SOURCE      Sorex fumeus (smoky shrew)
  ORGANISM  Sorex fumeus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Eulipotyphla; Soricidae;
            Soricinae; Sorex.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_026606085) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_029834395.1-RS_2023_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/04/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..755
                     /organism="Sorex fumeus"
                     /mol_type="mRNA"
                     /db_xref="taxon:62283"
                     /chromosome="Unknown"
     gene            1..755
                     /gene="CLDN7"
                     /note="claudin 7; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 15 Proteins"
                     /db_xref="GeneID:130024430"
     CDS             1..636
                     /gene="CLDN7"
                     /codon_start=1
                     /product="claudin-7"
                     /protein_id="XP_055971146.1"
                     /db_xref="GeneID:130024430"
                     /translation="
MANSGLQLLGFAMALLGWVALLACTAIPQWQMSSFAGDNIITSQAMYKGLWMECAIQSTGVMNCKIYDSVLALPASLQATRALMVVSLVLGFMAMIVATMGMKCTNCGGDDKVKKARIAMTGGIIFIVAGLAALIACSWSGNQIVRDFYNPLVPMNVKFEFGPAIFIGWAGSALVLLGGGLLSCSCPRSESKPAYHAPRSYPKPNSAKEYV"
     misc_feature    10..519
                     /gene="CLDN7"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
atggccaactcgggcctgcagctcctgggcttcgccatggccctgctaggctgggtggccctgctggcctgcaccgccattccgcagtggcagatgagctcgttcgcgggcgacaacatcatcacgtcccaggccatgtacaagggcctgtggatggagtgcgccatacagagcacgggcgtgatgaactgcaagatctacgactcggtgctcgccctgccggcgtctttgcaggctactcgagccctcatggtcgtgtccctggtgctgggcttcatggccatgatcgtggccacgatgggcatgaagtgtaccaactgtgggggagatgacaaagtaaagaaggcccgaatagccatgaccggaggtatcatttttatcgtggcaggtcttgctgccctaatagcttgctcctggtctggtaaccagattgtcagagacttttataacccattggtccctatgaatgttaagtttgagtttggccctgccatctttattggctgggcagggtctgcactggtccttctgggaggtggcctgctctcttgctcctgtcccaggagtgagagcaaaccagcataccatgcaccccgctcctaccctaaacccaactctgctaaggagtatgtgtgaactgggggataccctgatcccagcctggcagcctgagggtaagcagttacctgaaaggacatggagcagagttcagcctgtgggcagggcgtggaacctcccaatcactccagtcccaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]