2024-05-20 10:23:26, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_055986828 468 bp mRNA linear INV 09-MAY-2023 DEFINITION PREDICTED: Episyrphus balteatus sperm mitochondrial-associated cysteine-rich protein-like (LOC129909756), mRNA. ACCESSION XM_055986828 VERSION XM_055986828.1 DBLINK BioProject: PRJNA967719 KEYWORDS RefSeq; includes ab initio. SOURCE Episyrphus balteatus (marmalade hoverfly) ORGANISM Episyrphus balteatus Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Syrphoidea; Syrphidae; Syrphinae; Syrphini; Episyrphus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_079135) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_945859705.1-RS_2023_05 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 05/05/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..468 /organism="Episyrphus balteatus" /mol_type="mRNA" /db_xref="taxon:286459" /chromosome="2" gene 1..468 /gene="LOC129909756" /note="sperm mitochondrial-associated cysteine-rich protein-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 Proteins" /db_xref="GeneID:129909756" CDS 1..468 /gene="LOC129909756" /codon_start=1 /product="sperm mitochondrial-associated cysteine-rich protein-like" /protein_id="XP_055842803.1" /db_xref="GeneID:129909756" /translation="
MLMIKLSQRTCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPLPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCLVLSCLVLSCLVLSCLVLSCLVLSCLVLSCLVLSCLVLSCLVLSCLVLSCFILSCPFLSHYFIPLYMSSVLSHFLF"
ORIGIN
atgttgatgattaaattgtctcaaaggacatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccacttccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgttttatcttatcttgtccattcttgtcacattattttattcccttatatatgtcttctgtcctgtctcatttcttgttttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]