GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 10:23:26, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_055986828             468 bp    mRNA    linear   INV 09-MAY-2023
DEFINITION  PREDICTED: Episyrphus balteatus sperm mitochondrial-associated
            cysteine-rich protein-like (LOC129909756), mRNA.
ACCESSION   XM_055986828
VERSION     XM_055986828.1
DBLINK      BioProject: PRJNA967719
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Episyrphus balteatus (marmalade hoverfly)
  ORGANISM  Episyrphus balteatus
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Syrphoidea; Syrphidae; Syrphinae; Syrphini;
            Episyrphus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_079135) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_945859705.1-RS_2023_05
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 05/05/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..468
                     /organism="Episyrphus balteatus"
                     /mol_type="mRNA"
                     /db_xref="taxon:286459"
                     /chromosome="2"
     gene            1..468
                     /gene="LOC129909756"
                     /note="sperm mitochondrial-associated cysteine-rich
                     protein-like; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 20 Proteins"
                     /db_xref="GeneID:129909756"
     CDS             1..468
                     /gene="LOC129909756"
                     /codon_start=1
                     /product="sperm mitochondrial-associated cysteine-rich
                     protein-like"
                     /protein_id="XP_055842803.1"
                     /db_xref="GeneID:129909756"
                     /translation="
MLMIKLSQRTCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPLPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCLVLSCLVLSCLVLSCLVLSCLVLSCLVLSCLVLSCLVLSCLVLSCLVLSCFILSCPFLSHYFIPLYMSSVLSHFLF"
ORIGIN      
atgttgatgattaaattgtctcaaaggacatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccacttccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtccatgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgtcttgttttatcttatcttgtccattcttgtcacattattttattcccttatatatgtcttctgtcctgtctcatttcttgttttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]