LOCUS       XM_055088696            2558 bp    mRNA    linear   MAM 10-JAN-2025
DEFINITION  PREDICTED: Physeter macrocephalus dicer 1, ribonuclease III
            (DICER1), transcript variant X4, mRNA.
ACCESSION   XM_055088696
VERSION     XM_055088696.1
DBLINK      BioProject: PRJNA434122
KEYWORDS    RefSeq.
SOURCE      Physeter macrocephalus (sperm whale)
  ORGANISM  Physeter macrocephalus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha;
            Cetacea; Odontoceti; Physeteridae; Physeter.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_041224.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_002837175.3-RS_2025_01
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 01/08/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2558
                     /organism="Physeter macrocephalus"
                     /mol_type="mRNA"
                     /isolate="SW-GA"
                     /db_xref="taxon:9755"
                     /chromosome="11"
                     /sex="female"
                     /tissue_type="muscle"
                     /dev_stage="adult"
     gene            1..2558
                     /gene="DICER1"
                     /note="dicer 1, ribonuclease III; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     mRNAs, 7 Proteins"
                     /db_xref="GeneID:102977906"
     CDS             1179..2558
                     /gene="DICER1"
                     /codon_start=1
                     /product="endoribonuclease Dicer isoform X3"
                     /protein_id="XP_054944671.1"
                     /db_xref="GeneID:102977906"
                     /translation="

MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFNRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVSASWTKEKWNQEFTKHQVLVMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDEEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNR"

     misc_feature    1302..1895
                     /gene="DICER1"
                     /note="DEXH-box helicase domain of endoribonuclease Dicer;
                     Region: DEXHc_dicer; cd18034"
                     /db_xref="CDD:350792"
     misc_feature    order(1302..1313,1320..1322,1371..1394,1515..1517,
                     1704..1706,1797..1799)
                     /gene="DICER1"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:350792"
     misc_feature    order(1479..1484,1551..1556,1629..1631,1635..1640,
                     1647..1649,1722..1730)
                     /gene="DICER1"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:350792"
     misc_feature    1989..2273
                     /gene="DICER1"
                     /note="Partner-binding domain of the endoribonuclease
                     Dicer; Region: Dicer_PBD; cd15903"
                     /db_xref="CDD:277191"
     misc_feature    order(2004..2009,2016..2018,2022..2027,2202..2207,
                     2214..2219,2226..2228,2235..2240,2247..2249)
                     /gene="DICER1"
                     /note="Trbp binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:277191"
     misc_feature    2292..>2555
                     /gene="DICER1"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
ORIGIN      

ttttagccagtcacttactggatctctgtattttaattcacagctgcaagataaaatacacggttctgacctatgcaaatgaacaatttacataaatggggccgctgcccccatctcattttctggttatccctgttccggggtggggctgtggggtgggattagttgtctccccagatgcggagggccctggaccactaatgcaggggaaaagcaggcgagggggacggtcctttaaaaaaggtgcgggggcggcgaaaggaaagccgagccctgcgcacaacaattacgaccatggagaagggcctcgtttagggggccgtgggtgccagaaggggcaagaatggaggcggacgaattccgagagccagcagattctgccgactcaagcgagcgtccgcaaccccggcggcgcgcgggcccgggatggtggcgaaggtgcccagcggcgggccgtgtaacgtccggatcccgccccggctctgggccgcaaacacctcctgggcctctgccgctcgcgtccactgtctcccggctcctgagtggctggggggccgggattaacctttcaccgccgcgctctgtccaatcacaggctcgctctcatgccggcgcggggcgagtggagcgtgggggcgcggagggggcggtgcgggcgccgttgggattctccaagccgctgtgcgccgttgccgcaggccgtgcgcgggctgagggcgagcagggcgctgcgcagtctccgcaagcgccggcgggaggggtcgcggcggaggcgcggcgcagcgcggcgcaggctgcttcaggcccaggtgaatggagtaacctgacagcggggacgaggcgacggcgagcgggaggaaatggcggcggcggtggcggcgccgggcggcaccgggaggcctgggctgtgacgcgcgcgccggagcggggtccgatggttctcgaaggcccgcggcgccccgtgctgcaggttacctagggtatgaattaatacagacttggaaactgaaagaacttagaatcagcattttgagcagaagcttgggtatgctgtgattttccaataaactgctatcacaatgtcaaaatgcagttcagacaacagcaacacagagatctcaaacattaagacgtaagctgtgctagaacaaaaatgcaatgaaagaaacactggatgaatgaaaagccctgctttgcaacccctcagcatggcaggcctgcagctcatgacccctgcttcctcaccaatgggtcctttctttggactgccatggcaacaagaagcaattcatgataacatttatacgccaagaaaatatcaggttgaactgcttgaagcagctctggatcataataccatagtctgtttaaacactggctcagggaagacgtttattgcagtactactcactaaagagctgtcctatcagatcaggggagacttcaacagaaatggcaaaaggacggtgttcttggtcaactctgcaaaccaggttgctcaacaagtgtcagctgtcagaactcactcagatctcaaggttggggaatactcaaacctggaagtaagtgcatcttggacaaaagagaaatggaaccaagagtttactaagcaccaggttctcgttatgacttgctatgtcgccttgaatgttttgaaaaatggttacttatcactatcagacatcaaccttttggtgttcgatgagtgtcatcttgcaatcctagaccacccctaccgagaaattatgaagctctgtgaaaattgtccatcatgtcctcgtattttgggactaactgcttccattttaaatgggaaatgtgatccagaggaattggaagaaaagattcagaaactggagaaaattcttaagagtaatgctgaaactgcaactgacttggtggtcttagacagatatacttcccagccatgtgagattgtggtagactgtggaccatttactgacagaagtggcctttatgaaagactgctgatggaattagaagaagcacttaattttatcaatgactgtaacatatctgtacattcaaaggaaagagattctactttaatttctaaacagatactctcagactgtcgtgcggtattggtagttctgggaccctggtgtgcagataaagtagctggaatgatggtaagagaactacagaaatatatcaaacacgaacaagaggagctgcacaggaaatttctattgtttacagacactttcctaaggaaaatccatgcactatgtgaagagcacttctcacctgcctcacttgacctgaaatttgtaactcctaaagtaataaaactgcttgaaatcttacgcaaatataaaccttatgagcgacagcagtttgaaagcgttgagtggtataataataggaatcaggataattacgtgtcttggagtgattctgaggatgatgaggaggatgaagaaattgaagaaaaagaaaagccagagacaaattttccttctccatttaccaatattttgtgtggaattatttttgtggaaagaagatatacggcagttgtcttaaacaggtaa

//