2024-05-04 01:54:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_054468964 651 bp mRNA linear PRI 11-APR-2023 DEFINITION PREDICTED: Pongo pygmaeus claudin 17 (CLDN17), mRNA. ACCESSION XM_054468964 VERSION XM_054468964.1 DBLINK BioProject: PRJNA945458 KEYWORDS RefSeq. SOURCE Pongo pygmaeus (Bornean orangutan) ORGANISM Pongo pygmaeus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pongo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_072394) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_028885625.1-RS_2023_04 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 04/06/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..651 /organism="Pongo pygmaeus" /mol_type="mRNA" /isolate="AG05252" /db_xref="taxon:9600" /chromosome="21" /sex="male" /tissue_type="fibroblast" gene 1..651 /gene="CLDN17" /note="claudin 17; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:129022693" CDS 1..651 /gene="CLDN17" /codon_start=1 /product="claudin-17" /protein_id="XP_054324939.1" /db_xref="GeneID:129022693" /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALSPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERVRAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHIGQKRELGAALFLGWASTAVLFIGGGLLCGFCCCNRKKQGYRYPVPGYCVPHTDKQRNNDNA"
misc_feature 16..546 /gene="CLDN17" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
atggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtagggactcttgccacaacccttctgcctcagtggagagtatcagcttttgttggcagcaacattattgtctttgagaggctctgggaagggctttggatgaactgcatccgacaagccagggtccggttgcaatgcaagttctatagttccttgttggctctgtcgcctgccctggaaacagcccgggccctcatgtgtgtggctgttgctctctccttgatcgccctgcttattggcatctgtggcatgaagcaggtccagtgcacaggctctaacgagagggtcagagcataccttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggacagccaacataatcatcagagatttctacaatccagccatccacataggtcagaaacgagagctgggagcagcacttttccttggctgggcaagcactgctgtcctcttcattggagggggtctgctttgtggattttgctgctgcaacagaaagaagcaagggtacagatatccagtgcctggctactgtgtgccacacacagataagcaaagaaacaatgacaatgcttag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]