ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-10 19:24:07, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_054321500 3124 bp mRNA linear PRI 05-AUG-2025 DEFINITION PREDICTED: Homo sapiens Meis homeobox 3 (MEIS3), transcript variant X6, mRNA. ACCESSION XM_054321500 VERSION XM_054321500.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060943) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2025_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.4 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/01/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..3124 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="19" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..3124 /gene="MEIS3" /gene_synonym="MRG2" /note="Meis homeobox 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 33 ESTs, 150 long SRA reads, 7 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 19 samples with support for all annotated introns" /db_xref="GeneID:56917" /db_xref="HGNC:HGNC:29537" /db_xref="MIM:619443" CDS 1286..2677 /gene="MEIS3" /gene_synonym="MRG2" /codon_start=1 /product="homeobox protein Meis3 isoform X5" /protein_id="XP_054177475.1" /db_xref="GeneID:56917" /db_xref="HGNC:HGNC:29537" /db_xref="MIM:619443" /translation="
MCTLCTTMRGSYRRCPWISLSVCLSLCLCHCLLTPLSPSLFPPSQTLPSLPLGPPAHMSGISAWTGSSLPTEAAPGDLEGFKLGGSDTWGPQYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL"
misc_feature 1835..2089
/gene="MEIS3"
/gene_synonym="MRG2"
/note="N-terminal of Homeobox Meis and PKNOX1; Region:
Meis_PKNOX_N; pfam16493"
/db_xref="CDD:465140"
misc_feature order(2339..2350,2354..2356,2414..2416,2432..2434,
2471..2473,2477..2482,2489..2494,2498..2506)
/gene="MEIS3"
/gene_synonym="MRG2"
/note="DNA binding site [nucleotide binding]"
/db_xref="CDD:238039"
misc_feature order(2342..2344,2351..2353,2480..2482,2489..2494,
2501..2503)
/gene="MEIS3"
/gene_synonym="MRG2"
/note="specific DNA base contacts [nucleotide binding];
other site"
/db_xref="CDD:238039"
misc_feature 2390..2506
/gene="MEIS3"
/gene_synonym="MRG2"
/note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
/db_xref="CDD:428673"
ORIGIN
tccgcaccccctgtccctgcatcccccactctccggcgctggcccccattagcccatccgtcctctacaccacctcgctctctctctgcccctccctccgcccctgggtctcccagtccctgtgtgccccctctctgcccccaagtgtctcttcctggccctcggcctcgcctcctccccatcgtttagcttctccttctccctgcccctctgtccccctctgtctgccccactctcctcctcctttctgcctctctgtccccctctctctgtccctggtctcccccctctttctgcctctctatccccctctctctgccctcccccacccgcagtctctctcctctgttcctgggcttcctcctccatctcagccgcccgcacctcaccgtccccccttttttctgctctcctccgtccttcccttcgctctacttttgttccaagccgcccctgcctctccagggctaggagtgggacaggggtgggagaggtggtctcaccaggctgctggccccacggagcctgtctccctggggatgggaacggggatagaagacaggggaggaggcgcgcgcccgttttgggggttccgggtaggctgtgaggaccgcttttggtgagagtgccttgagcagcggggagcagttggattcaacttcagggcacaggagaagttaggagaagagggagagggaaagagtgggacacacagaaccagggtgcccagccaggcgagggtccgaggcaggaacgttctagcctcttcccgtgcgagtcctgctgcctctttgagcctccgtgtcttcatcactgaggaagggatttgacctgatgagaggaaggtgcccctggcttcccaggtgcatggttctgtgacgacaggacgcggtcgtcctaccccataatggtgtttctcttgggtgcgcaatcgtgtctgtatggtggtgcggagtgaccctctccggcaacaagtgctcacagcatgagccaggccctgtgctaaatgcctcattcattcattcatccatgtgccaaatgtctcaatcatgcattcattcttgtgcctggtgttgggctgtgtgcatgtgtgtgtgcatgtgtgtgtgtggggggggatttgggtgtgactgacacatgagtgtgcacgtgggttggtgtgtatggctgtgtctacatgtgtggtagattcacgtggcgagtggagtgtgacatgttgttgagacttactctgatgcgcttatctgccaactgtgaaatgaaatagaagacagggaggcttcgtatgtgtactttgtgtacaacaatgcgcggttcctacaggaggtgtccatggatctccctctctgtctgtctctctctctgtctctgtcactgtcttctcacgccactttctccatctcttttccctcccagccagaccctgccgtctctccctctgggtcctcctgcccacatgtcaggaatctctgcctggacggggtcctcactccccaccgaggcagctccaggggacctggagggcttcaagcttgggggctcagacacctggggaccacagtatgatgagctgccgcactacccaggcatcgtggatggccccgcagccctggctagcttcccagagacagtgcccgcagtaccagggccctatggcccgcaccggcctccccagcccctgcccccaggcttggacagcgacggcctgaagagggagaaggatgagatctatggacacccgctcttccccctcttggccctggtctttgagaaatgtgaactggctacatgctctccccgtgacggggccggagctgggctggggacaccccctggaggtgacgtctgctcctctgattccttcaacgaggacatcgctgcctttgccaagcaggttcgctctgagaggcccctcttctcctccaacccagaactggacaatctgatgatccaggccatccaggtgctgcggttccacctgctggagctggagaaggtccacgacctgtgcgacaacttctgtcaccgctacatcacctgcctcaagggaaagatgcccatcgacctggtcatcgaggatcgggacggcggctgcagggaggacttcgaggactacccagcctcctgccccagcctcccagaccagaataatatgtggattcgagaccatgaggatagtgggtctgtacatttggggaccccaggtccatccagtgggggcctggcctcccagagtggggacaactccagtgaccaaggagacgggctggacaccagcgtggcctctcccagttctggtggagaagatgaggacttggaccaggagcgacggcgaaacaagaagagggggatcttccccaaggtggccaccaacatcatgcgagcctggttgttccagcacctctcgcacccgtacccctcggaggagcagaagaaacagctggcgcaggacacggggctcaccatcctgcaagtcaacaactggttcattaacgcccggagacgcatcgtgcaacctatgatcgatcaatccaaccgcacagggcagggtgcagccttcagcccagagggccagcccatcgggggctataccgagacgcagccacacgtggccgtccggcctccgggatcagtggggatgagtttgaacttggaaggagaatggcattatctatagaggctgatgcaggagagacccagcctccggctgtgacccccagcctcacacctgcctctggttcccgcctggtcctccagcttcaggaccccacctccaaaggcccctctgctcaatgcctacctccctagggccctgctgggacatgggggcctgagtgcccatccaagggctctcaaggacaccggcaaggcctccaggccctgagccccacttctgccttcacctctgcctgggacccgagctgggctcctgggccttggtccccagaagatggcggctagggcctcgccgccaggacagagaagggacggggtggctgggcagtcagggaagtagggtcgcccggatccgacattttggagagattccttcactctcctgtcccccctacctcccttctctaatttcttcttttttttaatgataaagtcttaaaaacacgga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]