GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-10 19:24:07, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_054321500            3124 bp    mRNA    linear   PRI 05-AUG-2025
DEFINITION  PREDICTED: Homo sapiens Meis homeobox 3 (MEIS3), transcript variant
            X6, mRNA.
ACCESSION   XM_054321500
VERSION     XM_054321500.1
DBLINK      BioProject: PRJNA807723
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060943) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_009914755.1-RS_2025_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.4
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/01/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..3124
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="CHM13"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /sex="female"
                     /cell_line="CHM13htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..3124
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /note="Meis homeobox 3; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 mRNAs, 33 ESTs, 150
                     long SRA reads, 7 Proteins, and 99% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     19 samples with support for all annotated introns"
                     /db_xref="GeneID:56917"
                     /db_xref="HGNC:HGNC:29537"
                     /db_xref="MIM:619443"
     CDS             1286..2677
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /codon_start=1
                     /product="homeobox protein Meis3 isoform X5"
                     /protein_id="XP_054177475.1"
                     /db_xref="GeneID:56917"
                     /db_xref="HGNC:HGNC:29537"
                     /db_xref="MIM:619443"
                     /translation="
MCTLCTTMRGSYRRCPWISLSVCLSLCLCHCLLTPLSPSLFPPSQTLPSLPLGPPAHMSGISAWTGSSLPTEAAPGDLEGFKLGGSDTWGPQYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL"
     misc_feature    1835..2089
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    order(2339..2350,2354..2356,2414..2416,2432..2434,
                     2471..2473,2477..2482,2489..2494,2498..2506)
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(2342..2344,2351..2353,2480..2482,2489..2494,
                     2501..2503)
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    2390..2506
                     /gene="MEIS3"
                     /gene_synonym="MRG2"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      
tccgcaccccctgtccctgcatcccccactctccggcgctggcccccattagcccatccgtcctctacaccacctcgctctctctctgcccctccctccgcccctgggtctcccagtccctgtgtgccccctctctgcccccaagtgtctcttcctggccctcggcctcgcctcctccccatcgtttagcttctccttctccctgcccctctgtccccctctgtctgccccactctcctcctcctttctgcctctctgtccccctctctctgtccctggtctcccccctctttctgcctctctatccccctctctctgccctcccccacccgcagtctctctcctctgttcctgggcttcctcctccatctcagccgcccgcacctcaccgtccccccttttttctgctctcctccgtccttcccttcgctctacttttgttccaagccgcccctgcctctccagggctaggagtgggacaggggtgggagaggtggtctcaccaggctgctggccccacggagcctgtctccctggggatgggaacggggatagaagacaggggaggaggcgcgcgcccgttttgggggttccgggtaggctgtgaggaccgcttttggtgagagtgccttgagcagcggggagcagttggattcaacttcagggcacaggagaagttaggagaagagggagagggaaagagtgggacacacagaaccagggtgcccagccaggcgagggtccgaggcaggaacgttctagcctcttcccgtgcgagtcctgctgcctctttgagcctccgtgtcttcatcactgaggaagggatttgacctgatgagaggaaggtgcccctggcttcccaggtgcatggttctgtgacgacaggacgcggtcgtcctaccccataatggtgtttctcttgggtgcgcaatcgtgtctgtatggtggtgcggagtgaccctctccggcaacaagtgctcacagcatgagccaggccctgtgctaaatgcctcattcattcattcatccatgtgccaaatgtctcaatcatgcattcattcttgtgcctggtgttgggctgtgtgcatgtgtgtgtgcatgtgtgtgtgtggggggggatttgggtgtgactgacacatgagtgtgcacgtgggttggtgtgtatggctgtgtctacatgtgtggtagattcacgtggcgagtggagtgtgacatgttgttgagacttactctgatgcgcttatctgccaactgtgaaatgaaatagaagacagggaggcttcgtatgtgtactttgtgtacaacaatgcgcggttcctacaggaggtgtccatggatctccctctctgtctgtctctctctctgtctctgtcactgtcttctcacgccactttctccatctcttttccctcccagccagaccctgccgtctctccctctgggtcctcctgcccacatgtcaggaatctctgcctggacggggtcctcactccccaccgaggcagctccaggggacctggagggcttcaagcttgggggctcagacacctggggaccacagtatgatgagctgccgcactacccaggcatcgtggatggccccgcagccctggctagcttcccagagacagtgcccgcagtaccagggccctatggcccgcaccggcctccccagcccctgcccccaggcttggacagcgacggcctgaagagggagaaggatgagatctatggacacccgctcttccccctcttggccctggtctttgagaaatgtgaactggctacatgctctccccgtgacggggccggagctgggctggggacaccccctggaggtgacgtctgctcctctgattccttcaacgaggacatcgctgcctttgccaagcaggttcgctctgagaggcccctcttctcctccaacccagaactggacaatctgatgatccaggccatccaggtgctgcggttccacctgctggagctggagaaggtccacgacctgtgcgacaacttctgtcaccgctacatcacctgcctcaagggaaagatgcccatcgacctggtcatcgaggatcgggacggcggctgcagggaggacttcgaggactacccagcctcctgccccagcctcccagaccagaataatatgtggattcgagaccatgaggatagtgggtctgtacatttggggaccccaggtccatccagtgggggcctggcctcccagagtggggacaactccagtgaccaaggagacgggctggacaccagcgtggcctctcccagttctggtggagaagatgaggacttggaccaggagcgacggcgaaacaagaagagggggatcttccccaaggtggccaccaacatcatgcgagcctggttgttccagcacctctcgcacccgtacccctcggaggagcagaagaaacagctggcgcaggacacggggctcaccatcctgcaagtcaacaactggttcattaacgcccggagacgcatcgtgcaacctatgatcgatcaatccaaccgcacagggcagggtgcagccttcagcccagagggccagcccatcgggggctataccgagacgcagccacacgtggccgtccggcctccgggatcagtggggatgagtttgaacttggaaggagaatggcattatctatagaggctgatgcaggagagacccagcctccggctgtgacccccagcctcacacctgcctctggttcccgcctggtcctccagcttcaggaccccacctccaaaggcccctctgctcaatgcctacctccctagggccctgctgggacatgggggcctgagtgcccatccaagggctctcaaggacaccggcaaggcctccaggccctgagccccacttctgccttcacctctgcctgggacccgagctgggctcctgggccttggtccccagaagatggcggctagggcctcgccgccaggacagagaagggacggggtggctgggcagtcagggaagtagggtcgcccggatccgacattttggagagattccttcactctcctgtcccccctacctcccttctctaatttcttcttttttttaatgataaagtcttaaaaacacgga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]