GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-10 19:02:51, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_054321128             856 bp    mRNA    linear   PRI 05-AUG-2025
DEFINITION  PREDICTED: Homo sapiens divergent-paired related homeobox (DPRX),
            transcript variant X3, mRNA.
ACCESSION   XM_054321128
VERSION     XM_054321128.1
DBLINK      BioProject: PRJNA807723
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060943) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_009914755.1-RS_2025_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.4
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/01/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..856
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="CHM13"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /sex="female"
                     /cell_line="CHM13htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..856
                     /gene="DPRX"
                     /note="divergent-paired related homeobox; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 mRNA, 1 EST, 1 Protein, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     3 samples with support for all annotated introns"
                     /db_xref="GeneID:503834"
                     /db_xref="HGNC:HGNC:32166"
                     /db_xref="MIM:611165"
     CDS             255..830
                     /gene="DPRX"
                     /codon_start=1
                     /product="divergent paired-related homeobox isoform X1"
                     /protein_id="XP_054177103.1"
                     /db_xref="GeneID:503834"
                     /db_xref="HGNC:HGNC:32166"
                     /db_xref="MIM:611165"
                     /translation="
MPGSEDLRKGKDQMHSHRKRTMFTKKQLEDLNILFNENPYPNPSLQKEMASKIDIHPTVLQVWFKNHRAKLKKAKCKHIHQKQETPQPPIPEGGVSTSVGLRNADTLPRLPNAAHPIGLVYTGHRVPSFQLILYPNLKVPANDFIGHRIVHFGCCRDPNIYCLYPILESQVCAPSFHSGSPACSSNQSRER"
     misc_feature    306..473
                     /gene="DPRX"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
ORIGIN      
tcaagcgatgctcctgccttcatctcctgagtagctgggactacaggcacaccccacactgttagcctgagacagctatagggaaaggtcgcaggaagagtgttgggctcagacacccaagaggcctctttttttccaggaagccactcaccaatcaacatccagactccacattgggcccaggtctcagtggtcatctgcatcatcagttcttatccctggacctgaacccaggcgcacatctggattagaagatgccaggctcagaggatcttcgtaaaggcaaggaccagatgcattcacacaggaaacgaaccatgttcactaagaagcaactggaagatctgaacatcttgttcaatgagaacccatacccaaaccccagccttcagaaagaaatggcctcgaaaatagacatacacccaacagtactgcaggtctggttcaagaatcacagagcaaaactcaagaaagcgaaatgcaagcatattcatcaaaaacaagaaactccacaaccgccaataccagagggtggggtctccaccagtgtcggcctgagaaatgcagacacactacccagattgcccaacgctgctcacccgatcggcctggtgtacacgggtcatcgagtcccctcattccagctcatcctgtaccccaacctcaaggtccctgcaaatgacttcattggccacagaatagtccattttggctgctgccgagatcctaatatatactgcctctaccccattttggaatcccaagtttgcgctccaagcttccattctggctctcctgcctgttcatctaaccaaagtcgagagagatgataaatacaaaaagtcacatgttgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]