GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-01-25 21:26:11, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_054026417             918 bp    mRNA    linear   VRT 06-MAR-2023
DEFINITION  PREDICTED: Malaclemys terrapin pileata high mobility group AT-hook
            1 (HMGA1), transcript variant X3, mRNA.
ACCESSION   XM_054026417
VERSION     XM_054026417.1
DBLINK      BioProject: PRJNA938469
KEYWORDS    RefSeq.
SOURCE      Malaclemys terrapin pileata
  ORGANISM  Malaclemys terrapin pileata
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Testudinata; Testudines; Cryptodira; Durocryptodira;
            Testudinoidea; Emydidae; Malaclemys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_071508) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_027887155.1-RS_2023_03
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 03/02/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..918
                     /organism="Malaclemys terrapin pileata"
                     /mol_type="mRNA"
                     /isolate="rMalTer1"
                     /sub_species="pileata"
                     /db_xref="taxon:2991368"
                     /chromosome="4"
                     /sex="male"
                     /tissue_type="blood"
                     /dev_stage="juvenile"
                     /geo_loc_name="USA: Alabama"
                     /lat_lon="30.343790 N 88.131310 W"
                     /collection_date="2021-04-10"
                     /collected_by="Iwo Gross"
     gene            1..918
                     /gene="HMGA1"
                     /note="high mobility group AT-hook 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:128836290"
     CDS             134..427
                     /gene="HMGA1"
                     /codon_start=1
                     /product="high mobility group protein HMG-I/HMG-Y isoform
                     X3"
                     /protein_id="XP_053882392.1"
                     /db_xref="GeneID:128836290"
                     /translation="
MSESSAKSSQPLASKQEEDVSEKRGRGRPRKKPQQEPSEAPTPKRPRGRPKGSKNKATSKGRKAAVTPGRKPRGRPKKSQKDEEEVNVSQESSEEEQ"
     misc_feature    <134..421
                     /gene="HMGA1"
                     /note="DNA topoisomerase 2-like protein; Provisional;
                     Region: PTZ00108"
                     /db_xref="CDD:240271"
ORIGIN      
ccttcatttcttttgcaaagagcaggtagtgcattgggctcgcaagaaaccccgcctcctcctggccctttaaaggggcagatcccagagccatgtctccccctctccaaccaagaagagattgtgaaagacaatgagtgaatctagtgcaaaatccagccagcccttggcttccaaacaggaggaggacgtgtctgagaagagaggacggggacgacccaggaagaagcctcagcaggaacccagcgaggcaccaacccccaagagaccacgtggcagaccaaaggggagcaaaaataaggccacttctaaaggcaggaaagctgcagtaacacctgggaggaaacctcgaggtcggcccaaaaaatcgcagaaggacgaagaggaggtaaacgtttcgcaggagtcatccgaagaggagcagtgaaaacgcttgaacccggcactacctcatcattcaacttaccaatttctcgtcaagttcttggactgaggaaggaacgaaacaaaacaaaaatccttggtggtttttttttttttctcctccgcccccctgcacaactttctcacactcaaacagcagcagcaccggagtacagatcaaaccgatggagcggccgtcgcgctcactgacggacgctgttaactcgaagggggagaacgggctctgttgtttctctttcttagtggacagggttaaaatttagcctactggtttatgtagtttcttttgttcctagtgaaattcactgagggaaggcttctgtagaacagttgctttattgttttgtgatttatttttttttccaacacacttcttggtagggaaaggaggcgggggctgcttatggctgtctatattttagttttcttttttaaactacagtagttggggacagatctgtcaaaccccccccc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]