GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-08 09:46:38, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_053736243             285 bp    mRNA    linear   INV 16-FEB-2023
DEFINITION  Caenorhabditis remanei uncharacterized protein (GCK72_025216),
            partial mRNA.
ACCESSION   XM_053736243
VERSION     XM_053736243.1
DBLINK      BioProject: PRJNA933661
            BioSample: SAMN13028143
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis remanei
  ORGANISM  Caenorhabditis remanei
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 285)
  AUTHORS   Teterina,A.A., Willis,J.H. and Phillips,P.C.
  TITLE     Chromosome-level assembly of the Caenorhabditis remanei genome
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 285)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-FEB-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 285)
  AUTHORS   Teterina,A.A., Willis,J.H. and Phillips,P.C.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-DEC-2019) Institute of Ecology and Evolution,
            University of Oregon, 5289 University of Oregon, Eugene, OR 97403,
            USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_071333).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..285
                     /organism="Caenorhabditis remanei"
                     /mol_type="mRNA"
                     /strain="PX506"
                     /isolation_source="isopod"
                     /db_xref="taxon:31234"
                     /chromosome="X"
                     /sex="pooled males and females"
                     /tissue_type="whole organism"
                     /dev_stage="mixed stage"
                     /geo_loc_name="Canada: Toronto"
     gene            <1..>285
                     /locus_tag="GCK72_025216"
                     /db_xref="GeneID:78777891"
     CDS             1..285
                     /locus_tag="GCK72_025216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_053579809.1"
                     /db_xref="GeneID:78777891"
                     /translation="
MSGNKSETTESGKTTLPHERLIEAYNRRFEIQEEIDVMTKTTDGYQSRKFDQLTMQLTYVDNIISIGESDFDKKRAATVGKLFAVLRTLQHSNN"
ORIGIN      
atgtccggcaataaaagtgaaacgacagaaagtggaaaaactacgttgccgcatgaacgactgattgaagcatacaaccgaaggtttgaaattcaagaagagattgatgttatgaccaaaactacggatggctaccaatccaggaaatttgaccaattgacaatgcagctcacctatgttgacaatatcatctcaattggggagagcgactttgataagaaacgtgccgccaccgtgggaaagttgttcgctgtattgaggactctccaacattctaacaactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]