2024-05-20 09:23:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_052476330 1275 bp mRNA linear VRT 06-MAR-2023 DEFINITION PREDICTED: Oncorhynchus keta endothelin converting enzyme 2a (ece2a), transcript variant X10, mRNA. ACCESSION XM_052476330 VERSION XM_052476330.1 DBLINK BioProject: PRJNA906098 KEYWORDS RefSeq. SOURCE Oncorhynchus keta (chum salmon) ORGANISM Oncorhynchus keta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_068443) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_023373465.1-RS_2023_03 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 03/03/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1275 /organism="Oncorhynchus keta" /mol_type="mRNA" /strain="PuntledgeMale-10-30-2019" /db_xref="taxon:8018" /chromosome="23" /sex="male" /tissue_type="liver, spleen, heart, kidney" /dev_stage="Spawning" /country="Canada: Vancouver Island, Puntledge River Hatchery" /collection_date="2019-10-30" gene 1..1275 /gene="ece2a" /note="endothelin converting enzyme 2a; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:118378019" CDS 309..905 /gene="ece2a" /codon_start=1 /product="uncharacterized protein ece2a isoform X10" /protein_id="XP_052332290.1" /db_xref="GeneID:118378019" /translation="
MPSLCLVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLQPLQVSPNFPTCPLGI"
polyA_site 1275 /gene="ece2a" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
ctttgcgcggagtgtatgacggaaggtttcctgcgagcaacacgtggaatatggataacgctccaatgaacagctagcctatgttcctttcctttcatttcaaattattttcatgaaaactgcatgaagtgaggacataactgactgactgagggacagcgtggggatggagtatctacccgaccgtaactccaggtataaagacgtggactactgggatgagaggtacaagacagagaagtcgtttgaatggttcggagacttctccaagttccagcatctacttcagcgtcacgtcatgaaggacgatgccatccttgtgcttggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacttgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacttgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctacaacccctccaggtgtcccccaacttccccacttgtcctctgggtatttaaacctgtgttttctgtctgtctgttaccagtttgttttgttgtttcaagtcgaccagtgtgttgtcttagttcctggtttttcccagtctctctttttctcgtcctcctggtttttgacccttgactgtcctgaccctgtacctgcccgcctgaccactctgcctgttcctgacattgagcctgcctgccgtcctgtaccttgacctctactctggatttttgacccctgcctgccttgacctgtcgtttgcctgcctctgttgttacaattaacattgttacttcacacagtctacacttgggtcttaccttgttgcctgatacttctatccttacaaacaacagtcacgtcaagtaatctatgctttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]