GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 09:23:50, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_052476330            1275 bp    mRNA    linear   VRT 06-MAR-2023
DEFINITION  PREDICTED: Oncorhynchus keta endothelin converting enzyme 2a
            (ece2a), transcript variant X10, mRNA.
ACCESSION   XM_052476330
VERSION     XM_052476330.1
DBLINK      BioProject: PRJNA906098
KEYWORDS    RefSeq.
SOURCE      Oncorhynchus keta (chum salmon)
  ORGANISM  Oncorhynchus keta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_068443) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_023373465.1-RS_2023_03
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 03/03/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1275
                     /organism="Oncorhynchus keta"
                     /mol_type="mRNA"
                     /strain="PuntledgeMale-10-30-2019"
                     /db_xref="taxon:8018"
                     /chromosome="23"
                     /sex="male"
                     /tissue_type="liver, spleen, heart, kidney"
                     /dev_stage="Spawning"
                     /country="Canada: Vancouver Island, Puntledge River
                     Hatchery"
                     /collection_date="2019-10-30"
     gene            1..1275
                     /gene="ece2a"
                     /note="endothelin converting enzyme 2a; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:118378019"
     CDS             309..905
                     /gene="ece2a"
                     /codon_start=1
                     /product="uncharacterized protein ece2a isoform X10"
                     /protein_id="XP_052332290.1"
                     /db_xref="GeneID:118378019"
                     /translation="
MPSLCLVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLHPLQVSPIFPTCPCLQPLQVSPNFPTCPLGI"
     polyA_site      1275
                     /gene="ece2a"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
ctttgcgcggagtgtatgacggaaggtttcctgcgagcaacacgtggaatatggataacgctccaatgaacagctagcctatgttcctttcctttcatttcaaattattttcatgaaaactgcatgaagtgaggacataactgactgactgagggacagcgtggggatggagtatctacccgaccgtaactccaggtataaagacgtggactactgggatgagaggtacaagacagagaagtcgtttgaatggttcggagacttctccaagttccagcatctacttcagcgtcacgtcatgaaggacgatgccatccttgtgcttggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacttgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctccaccccctccaggtgtctcccatcttccccacttgtccttgtctccaccccctccaggtgtctcccatcttccccacctgtccttgtctacaacccctccaggtgtcccccaacttccccacttgtcctctgggtatttaaacctgtgttttctgtctgtctgttaccagtttgttttgttgtttcaagtcgaccagtgtgttgtcttagttcctggtttttcccagtctctctttttctcgtcctcctggtttttgacccttgactgtcctgaccctgtacctgcccgcctgaccactctgcctgttcctgacattgagcctgcctgccgtcctgtaccttgacctctactctggatttttgacccctgcctgccttgacctgtcgtttgcctgcctctgttgttacaattaacattgttacttcacacagtctacacttgggtcttaccttgttgcctgatacttctatccttacaaacaacagtcacgtcaagtaatctatgctttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]