2025-07-19 07:43:46, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_051753611 300 bp mRNA linear PLN 03-NOV-2022 DEFINITION Candida theae rpl36 (KGF57_004121), partial mRNA. ACCESSION XM_051753611 VERSION XM_051753611.1 DBLINK BioProject: PRJNA895880 BioSample: SAMN19021057 KEYWORDS RefSeq. SOURCE Candida theae ORGANISM Candida theae Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade; Candida. REFERENCE 1 (bases 1 to 300) AUTHORS Mixao,V., Del Olmo,V., Hegedusova,E., Saus,E., Pryszcz,L., Cillingova,A., Nosek,J. and Gabaldon,T. TITLE Genome analysis of five recently described species of the CUG-Ser clade uncovers Candida theae as a new hybrid lineage with pathogenic potential in the Candida parapsilosis species complex JOURNAL DNA Res 29 (2) (2022) PUBMED 35438177 REFERENCE 2 (bases 1 to 300) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (03-NOV-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 300) AUTHORS Mixao,V., Del Olmo,V. and Gabaldon,T. TITLE Direct Submission JOURNAL Submitted (08-JUL-2021) Life Sciences, Barcelona Supercomputing Center, Carrer Jordi Girona 29, Barcelona 08034, Spain COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_026261462). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..300 /organism="Candida theae" /mol_type="mRNA" /strain="CBS 12239" /isolation_source="Modern tea drink" /culture_collection="CBS:12239" /type_material="culture from type material of Candida theae" /db_xref="taxon:1198502" /chromosome="Unknown" gene <1..>300 /locus_tag="KGF57_004121" /db_xref="GeneID:76152179" CDS 1..300 /locus_tag="KGF57_004121" /codon_start=1 /transl_table=12 /product="rpl36" /protein_id="XP_051607389.1" /db_xref="GeneID:76152179" /translation="
MAKSGIAVGLNKGHKVATKEVAPKISYRKGALSQRTTFVRSIVKEVAGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRAGKKVEEMNKIIAESRRH"
misc_feature 7..294 /locus_tag="KGF57_004121" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:460088" ORIGIN
atggctaagtcaggaattgcagtaggtttaaacaaaggccacaaggttgccaccaaggaagttgccccaaagatttcgtacagaaagggtgccttgtcacaaagaaccacttttgttagatcaatcgttaaagaagttgccggattggctccatacgaaagaagattgattgaattgattagaaatgccggtgagaagagggctaagaagttggccaagaagagattgggtactcacaagagagccggaaagaaggttgaagaaatgaacaagatcattgctgaatcaagaagacactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]