GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-11 23:00:39, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_051753611             300 bp    mRNA    linear   PLN 03-NOV-2022
DEFINITION  Candida theae rpl36 (KGF57_004121), partial mRNA.
ACCESSION   XM_051753611
VERSION     XM_051753611.1
DBLINK      BioProject: PRJNA895880
            BioSample: SAMN19021057
KEYWORDS    RefSeq.
SOURCE      Candida theae
  ORGANISM  Candida theae
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Debaryomycetaceae; Candida/Lodderomyces clade;
            Candida.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Mixao,V., Del Olmo,V., Hegedusova,E., Saus,E., Pryszcz,L.,
            Cillingova,A., Nosek,J. and Gabaldon,T.
  TITLE     Genome analysis of five recently described species of the CUG-Ser
            clade uncovers Candida theae as a new hybrid lineage with
            pathogenic potential in the Candida parapsilosis species complex
  JOURNAL   DNA Res 29 (2) (2022)
   PUBMED   35438177
REFERENCE   2  (bases 1 to 300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-NOV-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 300)
  AUTHORS   Mixao,V., Del Olmo,V. and Gabaldon,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUL-2021) Life Sciences, Barcelona Supercomputing
            Center, Carrer Jordi Girona 29, Barcelona 08034, Spain
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_026261462).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="Candida theae"
                     /mol_type="mRNA"
                     /strain="CBS 12239"
                     /isolation_source="Modern tea drink"
                     /culture_collection="CBS:12239"
                     /type_material="culture from type material of Candida
                     theae"
                     /db_xref="taxon:1198502"
                     /chromosome="Unknown"
     gene            <1..>300
                     /locus_tag="KGF57_004121"
                     /db_xref="GeneID:76152179"
     CDS             1..300
                     /locus_tag="KGF57_004121"
                     /codon_start=1
                     /transl_table=12
                     /product="rpl36"
                     /protein_id="XP_051607389.1"
                     /db_xref="GeneID:76152179"
                     /translation="
MAKSGIAVGLNKGHKVATKEVAPKISYRKGALSQRTTFVRSIVKEVAGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRAGKKVEEMNKIIAESRRH"
     misc_feature    7..294
                     /locus_tag="KGF57_004121"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      
atggctaagtcaggaattgcagtaggtttaaacaaaggccacaaggttgccaccaaggaagttgccccaaagatttcgtacagaaagggtgccttgtcacaaagaaccacttttgttagatcaatcgttaaagaagttgccggattggctccatacgaaagaagattgattgaattgattagaaatgccggtgagaagagggctaagaagttggccaagaagagattgggtactcacaagagagccggaaagaaggttgaagaaatgaacaagatcattgctgaatcaagaagacactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]