GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 07:08:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_050700770            1071 bp    mRNA    linear   INV 21-SEP-2022
DEFINITION  PREDICTED: Spodoptera frugiperda uncharacterized LOC118280934
            (LOC118280934), mRNA.
ACCESSION   XM_050700770
VERSION     XM_050700770.1
DBLINK      BioProject: PRJNA849517
KEYWORDS    RefSeq.
SOURCE      Spodoptera frugiperda (fall armyworm)
  ORGANISM  Spodoptera frugiperda
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata;
            Ditrysia; Noctuoidea; Noctuidae; Amphipyrinae; Spodoptera.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_064230) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: Spodoptera frugiperda Annotation
                                           Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1071
                     /organism="Spodoptera frugiperda"
                     /mol_type="mRNA"
                     /isolate="SF20-4"
                     /db_xref="taxon:7108"
                     /chromosome="19"
                     /tissue_type="whole larval tissue"
                     /country="Australia"
                     /collection_date="2020-10"
     gene            1..1071
                     /gene="LOC118280934"
                     /note="uncharacterized LOC118280934; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:118280934"
     CDS             68..964
                     /gene="LOC118280934"
                     /codon_start=1
                     /product="uncharacterized protein LOC118280934"
                     /protein_id="XP_050556727.1"
                     /db_xref="GeneID:118280934"
                     /translation="
MSSKLTSDDRKMAKGTVIWLSVLFLGTVLGQPCPQPEPQFPCPCPAPEPAPCSPCDGAAQQIGPCNPCEPPVNYVYGQAPCGSILIRPGQIRFPTPPPIIVRPGEIRLPTPPAIWVKPAPVQPPAPQPITVRPPPVQPPTPAPFYVRVPAVNPPQPPPLIVRPPPVAVPRPPPMRVQPPSVQPPVPDALVVRPPKIVVPAPPTICFKPNPPQNFRTLGSATVCRLSNQNDGGSPCSCCPPPCPPCPPPCPCPCPPPCPPPCVPPCPCPCPCPCPCPCPCPPPCPPPCPCPCPPPPCIC"
     polyA_site      1071
                     /gene="LOC118280934"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
atagggtatattttgaattgtgttcagaaatctaagatggcggcttgtctagggtataaaagatgcaatgtcttccaaactaacatcagacgatcgaaaaatggcaaagggcacagtcatatggttatcggttctattcctgggcacagtactgggacagccgtgcccgcagccggagccgcagttcccctgcccctgcccagccccggagcctgccccctgcagcccctgcgatggagcagcccaacagattggcccctgcaacccgtgtgagccaccggtcaattatgtctacggtcaggcaccttgtggttcaatcctaatcaggccaggacagatccggttcccaacgccacccccgatcatagtccgccccggagagatcaggctgcccactccccccgcgatctgggtcaaacctgcccccgtgcagccaccagcgccgcagcccattactgtccgcccaccacccgtgcagccgccaactcctgcccccttctacgtgagggtgccggctgtgaaccccccacaaccacccccattgatcgtccgacctccaccagtggctgtgccaagaccaccaccgatgagggtacaaccaccatcagtccagccgccagtaccagacgcactagtcgtgcgaccgccgaagatcgtcgtccccgcaccccctaccatctgcttcaagccaaaccccccacagaacttcaggaccttgggatcagccaccgtttgccgtctatccaaccagaatgatgggggatcaccttgttcttgctgtccccccccgtgtcccccctgtccccctccttgcccgtgcccctgtcctcccccttgtccaccaccgtgcgtccccccttgtccgtgtccgtgtccgtgtccgtgtccgtgtccgtgtccgtgtcccccaccgtgtcccccgccgtgcccgtgcccatgcccgccacccccctgcatatgctaagtttatgtaacaatttaatatatatgtatttgtatgtatataatatataacggtatacatttgtaattgattgagcgttttgaaatatagtgcgggttatttgagca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]