LOCUS       XM_050578198             459 bp    mRNA    linear   INV 09-SEP-2022
DEFINITION  PREDICTED: Adelges cooleyi uncharacterized LOC126841614
            (LOC126841614), mRNA.
ACCESSION   XM_050578198
VERSION     XM_050578198.1
DBLINK      BioProject: PRJNA877624
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Adelges cooleyi (spruce gall adelgid)
  ORGANISM  Adelges cooleyi
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha;
            Aphidomorpha; Phylloxeroidea; Adelgidae; Adelges; Gilletteella.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_026096076) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: Adelges cooleyi Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 16% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..459
                     /organism="Adelges cooleyi"
                     /mol_type="mRNA"
                     /isolate="19-005CV"
                     /isolation_source="galling 4th instar nymphs"
                     /host="Picea sp."
                     /db_xref="taxon:133065"
                     /chromosome="Unknown"
                     /tissue_type="whole body"
                     /geo_loc_name="USA: Idaho, Franklin county, ID-36 through
                     Emigration Canyon"
                     /collection_date="2019-07-23"
                     /identified_by="Carol von Dohlen"
     gene            1..459
                     /gene="LOC126841614"
                     /note="uncharacterized LOC126841614; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:126841614"
     CDS             1..459
                     /gene="LOC126841614"
                     /codon_start=1
                     /product="uncharacterized protein LOC126841614"
                     /protein_id="XP_050434155.1"
                     /db_xref="GeneID:126841614"
                     /translation="

MAPLERDPPKFLFDHITDINEDFLTDDEEELFPERLIYNDIDTRDRDTDEEIDINTDELNNYIPEIVLEVIRQWSTYFNSAVPPLVNNHDRKTEDSDDESIETDETDDRETEDNDDESIETDETDDRETEDNDDTETEDSDDKETEDNDDTE"

ORIGIN      

atggcaccgttagaaagagatccacccaaattcttatttgatcatataacagacataaacgaagacttcttgacggacgacgaagaagagttatttccagaacgccttatatacaacgacatagacacaagagatagagacacggacgaagagattgacataaacaccgacgagttaaataactatatacctgaaatagtattggaagtcattagacaatggagtacatactttaatagtgctgttccgccacttgtcaacaaccatgacagaaagacagaggacagcgatgacgagtcaattgagacagacgaaaccgacgacagagagacagaagacaacgatgacgagtcaattgagacagacgaaaccgacgatagagagacagaggacaacgatgacacagagacagaggacagcgatgacaaagagacagaggacaacgatgacacagaatga

//