GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-29 20:43:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_050354696            1130 bp    mRNA    linear   PLN 18-MAY-2023
DEFINITION  PREDICTED: Mercurialis annua uncharacterized LOC126660969
            (LOC126660969), mRNA.
ACCESSION   XM_050354696
VERSION     XM_050354696.2
DBLINK      BioProject: PRJNA872570
KEYWORDS    RefSeq.
SOURCE      Mercurialis annua (annual mercury)
  ORGANISM  Mercurialis annua
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae;
            Acalyphoideae; Acalypheae; Mercurialis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_065577) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 18, 2023 this sequence version replaced XM_050354696.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_937616625.2-RS_2023_05
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 05/10/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1130
                     /organism="Mercurialis annua"
                     /mol_type="mRNA"
                     /db_xref="taxon:3986"
                     /linkage_group="LG8"
     gene            1..1130
                     /gene="LOC126660969"
                     /note="uncharacterized LOC126660969; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:126660969"
     CDS             23..808
                     /gene="LOC126660969"
                     /codon_start=1
                     /product="uncharacterized protein LOC126660969"
                     /protein_id="XP_050210653.1"
                     /db_xref="GeneID:126660969"
                     /translation="
MNFRVINLNDDFQTLSHKLNTSVHAEIEFLTTDLLHFRNLSRVQKNELNVLVKGKYDQRRLMNIRQLSSPERRALEYGDSIFLERPVVLGLPAGNRQDGILLVLDFSDDDEQDENPAIIPIPGGDEKDEMPAGGDEKDEMPAGGDEKDELTEVLAVPGGDEKDELTEVLAKDEMPAGGDEKDELTEFLAVPGGDEIDEMAEVLGIPGGDEIDKLAVVMDQAQSEGTLLNQPIETMAQYAARIGVENQKFDGDVWDSFTNSF"
     misc_feature    <350..>658
                     /gene="LOC126660969"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03169"
                     /db_xref="CDD:223003"
ORIGIN      
tcagtccctattaacgtaaaccatgaatttcagagttattaacctaaacgatgattttcaaactctctcgcataagctaaacacctctgtgcatgccgaaatagagttcttgactacggatttgttacattttcgaaatctgagtagagttcaaaagaatgaactaaatgttctagtgaagggaaaatatgatcaaagaagactaatgaacattcggcaattgtcttctccggaaagacgggcattagaatacggagattccatatttcttgaaaggccggtggttcttggattgcccgccggtaatcgacaagatggaattcttttggttcttgatttttcggacgatgatgaacaagacgaaaatccggcgattattccaattccgggcggtgatgaaaaagatgaaatgccggcgggcggtgatgaaaaagatgaaatgccggcgggcggtgatgaaaaagatgaattgacggaggttcttgcagtaccgggcggtgatgaaaaagatgaattgacggaggttcttgcaaaagatgaaatgccggcgggcggcgatgaaaaagatgaattgacagagtttcttgcagtaccgggcggtgatgaaatagatgaaatggcggaggttcttggaatcccgggcggtgatgaaatagataaattggcggtggttatggaccaagcccaatcagagggcactctgttgaaccagcccattgaaacgatggcccaatatgcagcgaggataggggtggaaaaccaaaagtttgacggtgatgtttgggactcgtttacaaattcattttaattccgtttaatatcaattactgccgtagcttactggtaattgacgccagagttcgaaaccaattttcaatctttcttattcactttttagggttttatttgcatttttttaattgttttcatcagttcagagggtcattagtgacgatttgctttgtgggtttttctaattctaattctaattccaattccaattttcattatattttatttttctagtaactatgatgcgagatttagtgtttgaaatttaagatttaaaattttcagttttgaatttagggtctaagatttagaatttacggtttgtaacttaatattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]