2024-04-29 20:43:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_050354696 1130 bp mRNA linear PLN 18-MAY-2023 DEFINITION PREDICTED: Mercurialis annua uncharacterized LOC126660969 (LOC126660969), mRNA. ACCESSION XM_050354696 VERSION XM_050354696.2 DBLINK BioProject: PRJNA872570 KEYWORDS RefSeq. SOURCE Mercurialis annua (annual mercury) ORGANISM Mercurialis annua Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Mercurialis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_065577) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 18, 2023 this sequence version replaced XM_050354696.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_937616625.2-RS_2023_05 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 05/10/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1130 /organism="Mercurialis annua" /mol_type="mRNA" /db_xref="taxon:3986" /linkage_group="LG8" gene 1..1130 /gene="LOC126660969" /note="uncharacterized LOC126660969; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:126660969" CDS 23..808 /gene="LOC126660969" /codon_start=1 /product="uncharacterized protein LOC126660969" /protein_id="XP_050210653.1" /db_xref="GeneID:126660969" /translation="
MNFRVINLNDDFQTLSHKLNTSVHAEIEFLTTDLLHFRNLSRVQKNELNVLVKGKYDQRRLMNIRQLSSPERRALEYGDSIFLERPVVLGLPAGNRQDGILLVLDFSDDDEQDENPAIIPIPGGDEKDEMPAGGDEKDEMPAGGDEKDELTEVLAVPGGDEKDELTEVLAKDEMPAGGDEKDELTEFLAVPGGDEIDEMAEVLGIPGGDEIDKLAVVMDQAQSEGTLLNQPIETMAQYAARIGVENQKFDGDVWDSFTNSF"
misc_feature <350..>658 /gene="LOC126660969" /note="hypothetical protein; Provisional; Region: PHA03169" /db_xref="CDD:223003" ORIGIN
tcagtccctattaacgtaaaccatgaatttcagagttattaacctaaacgatgattttcaaactctctcgcataagctaaacacctctgtgcatgccgaaatagagttcttgactacggatttgttacattttcgaaatctgagtagagttcaaaagaatgaactaaatgttctagtgaagggaaaatatgatcaaagaagactaatgaacattcggcaattgtcttctccggaaagacgggcattagaatacggagattccatatttcttgaaaggccggtggttcttggattgcccgccggtaatcgacaagatggaattcttttggttcttgatttttcggacgatgatgaacaagacgaaaatccggcgattattccaattccgggcggtgatgaaaaagatgaaatgccggcgggcggtgatgaaaaagatgaaatgccggcgggcggtgatgaaaaagatgaattgacggaggttcttgcagtaccgggcggtgatgaaaaagatgaattgacggaggttcttgcaaaagatgaaatgccggcgggcggcgatgaaaaagatgaattgacagagtttcttgcagtaccgggcggtgatgaaatagatgaaatggcggaggttcttggaatcccgggcggtgatgaaatagataaattggcggtggttatggaccaagcccaatcagagggcactctgttgaaccagcccattgaaacgatggcccaatatgcagcgaggataggggtggaaaaccaaaagtttgacggtgatgtttgggactcgtttacaaattcattttaattccgtttaatatcaattactgccgtagcttactggtaattgacgccagagttcgaaaccaattttcaatctttcttattcactttttagggttttatttgcatttttttaattgttttcatcagttcagagggtcattagtgacgatttgctttgtgggtttttctaattctaattctaattccaattccaattttcattatattttatttttctagtaactatgatgcgagatttagtgtttgaaatttaagatttaaaattttcagttttgaatttagggtctaagatttagaatttacggtttgtaacttaatattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]