GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-29 05:17:08, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_048943600             736 bp    mRNA    linear   VRT 07-JUL-2022
DEFINITION  PREDICTED: Lagopus muta mitochondrial ribosomal protein L35
            (MRPL35), transcript variant X1, mRNA.
ACCESSION   XM_048943600
VERSION     XM_048943600.1
DBLINK      BioProject: PRJNA853367
KEYWORDS    RefSeq.
SOURCE      Lagopus muta (rock ptarmigan)
  ORGANISM  Lagopus muta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Tetraoninae; Lagopus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_064436) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: Lagopus muta Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..736
                     /organism="Lagopus muta"
                     /mol_type="mRNA"
                     /isolate="bLagMut1"
                     /db_xref="taxon:64668"
                     /chromosome="4"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="adult"
                     /country="Iceland: Husavik, NE"
                     /lat_lon="66.088900 N 17.264700 W"
                     /collected_by="Kristinn P. Magnusson"
     gene            1..736
                     /gene="MRPL35"
                     /note="mitochondrial ribosomal protein L35; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:125692711"
     CDS             132..653
                     /gene="MRPL35"
                     /codon_start=1
                     /product="39S ribosomal protein L35, mitochondrial isoform
                     X1"
                     /protein_id="XP_048799557.1"
                     /db_xref="GeneID:125692711"
                     /translation="
MAAAAVRGALAGMLRPLARWAPVAAGRTASVHCCHSRARAAAPLGKPLTLGIVPGGGSALLSRLTPLLPNLLQQPVRPLTYCSLRKGKRKSVKAVVKRFLRLHNGLWVRRKSGYKKRLWKKSTAQKKRLREFVLCNRTQCKLLDKMTTSFWKRRNWYVDDPYQKYHDRTNLPL"
     misc_feature    390..569
                     /gene="MRPL35"
                     /note="Ribosomal protein L35; Region: Ribosomal_L35p;
                     pfam01632"
                     /db_xref="CDD:426356"
     polyA_site      736
                     /gene="MRPL35"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
ctcggtccgccattttagaaagcgcccggagggggccgcgctcctcccagcggggacgcggcgctctgcagccgtgtgttggcgcggcccggcctgatctccgccggctgccgtaggctgggcgcggggacatggcggcagcggcggtgcgaggggctctggcggggatgctgcggccgctcgcgcgctgggctcccgtcgctgcgggacgaaccgcgtccgtccactgctgccacagccgagcgcgggcggcggctccgctggggaaaccgctgaccctcggcatcgtgcccggcgggggttccgcgctgctcagcagactcacacctctacttccaaacctacttcagcagcccgtaaggcctctcacttactgtagtctacggaagggaaagaggaagtctgtgaaagctgttgttaagaggtttctccgactgcacaatggtctttgggttaggagaaagtctggttacaagaagagattgtggaagaagtctactgcccagaagaagcgcttgagagagtttgtgttgtgcaacagaacgcagtgtaaactcctggataagatgaccacttctttctggaaaagaagaaattggtatgttgatgatccctaccagaagtatcacgaccgcacaaatcttcctctgtaggaatctgtaattattttataaataaacatatgcgtatcatctgctcagaagtatggcccaaaataaaggaatagtaaagacta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]