2024-04-29 05:17:08, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_048943600 736 bp mRNA linear VRT 07-JUL-2022 DEFINITION PREDICTED: Lagopus muta mitochondrial ribosomal protein L35 (MRPL35), transcript variant X1, mRNA. ACCESSION XM_048943600 VERSION XM_048943600.1 DBLINK BioProject: PRJNA853367 KEYWORDS RefSeq. SOURCE Lagopus muta (rock ptarmigan) ORGANISM Lagopus muta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Tetraoninae; Lagopus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_064436) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: Lagopus muta Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..736 /organism="Lagopus muta" /mol_type="mRNA" /isolate="bLagMut1" /db_xref="taxon:64668" /chromosome="4" /sex="female" /tissue_type="blood" /dev_stage="adult" /country="Iceland: Husavik, NE" /lat_lon="66.088900 N 17.264700 W" /collected_by="Kristinn P. Magnusson" gene 1..736 /gene="MRPL35" /note="mitochondrial ribosomal protein L35; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:125692711" CDS 132..653 /gene="MRPL35" /codon_start=1 /product="39S ribosomal protein L35, mitochondrial isoform X1" /protein_id="XP_048799557.1" /db_xref="GeneID:125692711" /translation="
MAAAAVRGALAGMLRPLARWAPVAAGRTASVHCCHSRARAAAPLGKPLTLGIVPGGGSALLSRLTPLLPNLLQQPVRPLTYCSLRKGKRKSVKAVVKRFLRLHNGLWVRRKSGYKKRLWKKSTAQKKRLREFVLCNRTQCKLLDKMTTSFWKRRNWYVDDPYQKYHDRTNLPL"
misc_feature 390..569 /gene="MRPL35" /note="Ribosomal protein L35; Region: Ribosomal_L35p; pfam01632" /db_xref="CDD:426356" polyA_site 736 /gene="MRPL35" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
ctcggtccgccattttagaaagcgcccggagggggccgcgctcctcccagcggggacgcggcgctctgcagccgtgtgttggcgcggcccggcctgatctccgccggctgccgtaggctgggcgcggggacatggcggcagcggcggtgcgaggggctctggcggggatgctgcggccgctcgcgcgctgggctcccgtcgctgcgggacgaaccgcgtccgtccactgctgccacagccgagcgcgggcggcggctccgctggggaaaccgctgaccctcggcatcgtgcccggcgggggttccgcgctgctcagcagactcacacctctacttccaaacctacttcagcagcccgtaaggcctctcacttactgtagtctacggaagggaaagaggaagtctgtgaaagctgttgttaagaggtttctccgactgcacaatggtctttgggttaggagaaagtctggttacaagaagagattgtggaagaagtctactgcccagaagaagcgcttgagagagtttgtgttgtgcaacagaacgcagtgtaaactcctggataagatgaccacttctttctggaaaagaagaaattggtatgttgatgatccctaccagaagtatcacgaccgcacaaatcttcctctgtaggaatctgtaattattttataaataaacatatgcgtatcatctgctcagaagtatggcccaaaataaaggaatagtaaagacta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]