GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-11-04 11:24:47, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_047628064            1177 bp    mRNA    linear   INV 08-APR-2022
DEFINITION  PREDICTED: Penaeus chinensis uncharacterized LOC125035825
            (LOC125035825), mRNA.
ACCESSION   XM_047628064
VERSION     XM_047628064.1
DBLINK      BioProject: PRJNA822080
KEYWORDS    RefSeq.
SOURCE      Penaeus chinensis
  ORGANISM  Penaeus chinensis
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
            Dendrobranchiata; Penaeoidea; Penaeidae; Penaeus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_061838) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Penaeus chinensis Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1177
                     /organism="Penaeus chinensis"
                     /mol_type="mRNA"
                     /isolation_source="conservation base of Haifeng
                     Aquaculture Co., Ltd."
                     /db_xref="taxon:139456"
                     /chromosome="20"
                     /sex="male"
                     /tissue_type="muscle"
                     /geo_loc_name="China: Weifang of Shandong Province"
                     /collection_date="2019-12"
                     /breed="Huanghai No. 1"
     gene            1..1177
                     /gene="LOC125035825"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 2 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:125035825"
     CDS             284..1042
                     /gene="LOC125035825"
                     /codon_start=1
                     /product="uncharacterized protein LOC125035825"
                     /protein_id="XP_047484020.1"
                     /db_xref="GeneID:125035825"
                     /translation="
MRNIVPDSMGMDELRRNIVPVSIGKEEALQSKNIVPDSMGKDELRRNIVPVSIGKEEALQSKNIVPDSMGMDELRRNIVPVSIGKEEALQSKNIVPDSMAKDELRRNIVPVSIGKEEALQSKNIVPDSMAKDELRRNIVPVSIGKEEALQSKNIVPDSMAKDELRRNIVPVSIGKEEALQSKNIVPDSMAKDELRRNIVPVSIGKEEALQSKNIVPDSMAKDELRAEHRPSQYWEGGGTAVQEHRPRQYGEG"
ORIGIN      
ttatttaaaactattgattaatcttttgcttttgagtgcaatttcttgtgtagatctcaacaggataaacaccactcacaacgagacgaccctgtctgacattgtctcctaggtcccccaagccatactgaccctcgagggcatagcgaatggaacggtcctagccaatgtcaccaccggtaagcggagcaccatcccagagaagggggcactccggctaaataaaacggtcctggccaatgccaccaacattgtcagtgattaagtgaacttcacccctggtatgcggaacatcgtcccagacagtatggggatggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggggaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggggatggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcgggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggcactgcagtccaagaacatcgtcccagacagtatggcgaaggatgaactgcggcggaacatcgtcccagtcagtattgggaaggaggaggc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]