GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-25 13:50:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_047332944            2553 bp    mRNA    linear   VRT 01-APR-2022
DEFINITION  PREDICTED: Scophthalmus maximus Fas apoptotic inhibitory molecule
            2b (faim2b), transcript variant X3, mRNA.
ACCESSION   XM_047332944
VERSION     XM_047332944.1
DBLINK      BioProject: PRJNA821077
KEYWORDS    RefSeq.
SOURCE      Scophthalmus maximus (turbot)
  ORGANISM  Scophthalmus maximus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Carangaria; Pleuronectiformes; Pleuronectoidei;
            Scophthalmidae; Scophthalmus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_061520) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Scophthalmus maximus Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2553
                     /organism="Scophthalmus maximus"
                     /mol_type="mRNA"
                     /strain="ysfricsl-2021"
                     /db_xref="taxon:52904"
                     /chromosome="6"
                     /sex="female"
                     /tissue_type="muscle"
     gene            1..2553
                     /gene="faim2b"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 1 sample with support for all annotated introns"
                     /db_xref="GeneID:118308928"
     CDS             332..1024
                     /gene="faim2b"
                     /codon_start=1
                     /product="fas apoptotic inhibitory molecule 2b isoform X3"
                     /protein_id="XP_047188900.1"
                     /db_xref="GeneID:118308928"
                     /translation="
MQAQFSWDDKTIRRTFIRKVYAILMVQLLVTVAIVGLFTFCAPVRFFIQTHPGLYMASYIMFFFTYIALSCCGDLRRQFPWNIILLVLFTLSISFMMGFVSSFYNTKSVLLCLGITALVCLSVTIFSFQSKIDVTSYQGVLFSLCMVMLLCAITISIVVPFGYVPWLHALYAVTGAVLFTLFLAFDTQMLLGNKRYSISPEEYIFATLSLYLDVIYLFSFLLQLLGGGRS"
     misc_feature    347..1009
                     /gene="faim2b"
                     /note="Proteins similar to and including lifeguard (LFG),
                     a putative regulator of apoptosis; Region: LFG_like;
                     cd10428"
                     /db_xref="CDD:198410"
ORIGIN      
tttagtaccttttttggagttggactgaaatgttagcatttaacttttttttcacttcaatttctttctttaactttttacttttactgtgaaccccagccttcaaggtcataggagagtcccaaattgcaatttgaacatttttcaacaccctaaattggtaaaagaaaaacaaaaaaacaataataataacaaagatcatctgaaatctctcaaaggtccagtgcaaagactgaatggaccacgtggcgagaccggttactcatgaacacaggtgaacgacgacattgagccgcccagctaccaggtggcaacagcagactatgaggagatgcaggctcagttctcctgggacgacaagaccatccggcgaaccttcatcaggaaggtctacgccattctcatggttcagctccttgtgaccgtggccattgttggtctcttcacattctgcgcacctgtgaggtttttcatccagacccatcctggcttgtacatggcatcttatatcatgttcttcttcacctacatcgcgctgtcctgctgtggagatctgaggaggcagtttccctggaacatcattctgctggttctctttactttgagcatttccttcatgatgggatttgtgtcaagcttttacaacaccaagtccgtgttgctgtgcctgggcatcacagctctggtgtgtctctctgtcaccatcttcagcttccagagcaagatcgatgtcacgtcgtaccagggcgtcctgttttccctgtgcatggtcatgcttctctgtgccatcaccatctccatcgttgtgccctttggatacgttccctggttacacgctctttatgcggtgacaggagccgtcctcttcactctgttcctggcatttgacactcagatgctgctagggaacaagcgctactccataagtccggaggaatacattttcgccaccctcagcctctacctggacgtcatctacctgttcagcttcctgctgcagctcctgggaggaggccgctcgtgaagagcctgatccaccccatcgtacacctgaaccgtttaaactctcagaccacctaggatttgttcctcccgtgctcaacatgagcacgggaggaacacgagcattaaattgaccccaagaggtggggtaatttctgatgaattaccccacctctctttttaaaacatgcattgaagctgaaagcaagtgagagtaatcggttcgttccatgcttttggttttgcaatcttgtgtgtacaatcttgctgctggtttggtcccgacatcgcctgtgtcatacctcactatagctgttcactgtactctggccattcctgtaaatctggttttgtgttaccgaagggtcggctgccgtcctcgctgtcccacagtgcgtgttcacacagtcattaggcccatcagtggacagaagcagccacagtcacagagttgggactctgtttttttgtctccatcactgagccaaaatggaaatctgcactttgaagctcagcagggttgagcttgttataatagccgagtgtttcacaagctgcacagataaggcttgttttacacttgtttgtttttttaatgcacggcatcataaaaatgaatgttttaatgtttgtgtttgtgtgtgtgtgtgtgatatatctgaagctcacaaagtccaacctcaaagggagagtgtgacagtactttctgtcattaaagatgcattttctcagtgacttgaatgtggcctttgggatgtgatagaaaagccgatgatcagagtgtgaaccgtagaaatgttttacctgtacagtaaatttacctggacacatgttaatattttttacaaagacattgaggctgtgtacattcaatattgtcatcattaaaataaacctaactcatgaacagtggtgtgcctggcttgcatgtaaaagacgatagatgtcattactgcagttctgtgttatgacattcaatcatttctgcacaactctgtgccgagacccccagatttacctcaactgcctcaagatctttgctttgactccaccgatctgctgagatatcatggcaaccaggccaaacaatttgtatcaggtcacagtgaccttgaccttctgatcagaacatctgtgagtgtttttgaatgtttgtgccaaatctgaagaaaccccttcgaggctgtcttgaaatattgcattcaagaggccaaaatgtgttttgtgaggtcacaatgaccttagctcaacttaagagtcaaagggaatatttatgccaaatgagtgtttcttatttttgtcctctgcccagagccgcatgtctcctcacctctcacacctaacatgcctaacagggcacttcttcacctgatctcctacactttgtcctacagaacatattgagctgtcggttcttaaccctcccataatagtcagggttcagtagcaatttctgctctaacatgcaacataaacatctttttttgaatcttactaggaaaacttggacccttgaaacaggatgtgaggacccagctgccgcaaacaggc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]