LOCUS       XM_046918643            1753 bp    mRNA    linear   VRT 01-MAR-2022
DEFINITION  PREDICTED: Gallus gallus dicer 1, ribonuclease III (DICER1),
            transcript variant X10, mRNA.
ACCESSION   XM_046918643
VERSION     XM_046918643.1
DBLINK      BioProject: PRJNA698614
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_052577.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Gallus gallus Annotation Release 106
            Annotation Version          :: 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1753
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /isolate="bGalGal1"
                     /db_xref="taxon:9031"
                     /chromosome="5"
                     /sex="female"
                     /tissue_type="blood"
                     /geo_loc_name="USA: Fayetteville"
                     /lat_lon="36.0822 N 94.1719 W"
                     /collection_date="20-May-2019"
                     /collected_by="Nick Anthony"
     gene            1..1753
                     /gene="DICER1"
                     /gene_synonym="dicer"
                     /note="dicer 1, ribonuclease III; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     ESTs, 253 long SRA reads, 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 86 samples with support for all annotated
                     introns"
                     /db_xref="CGNC:8359"
                     /db_xref="GeneID:423437"
     misc_feature    1
                     /gene="DICER1"
                     /gene_synonym="dicer"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             374..1753
                     /gene="DICER1"
                     /gene_synonym="dicer"
                     /codon_start=1
                     /product="endoribonuclease Dicer isoform X2"
                     /protein_id="XP_046774599.1"
                     /db_xref="GeneID:423437"
                     /db_xref="CGNC:8359"
                     /translation="

MKSPALQSLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFNKNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSSLEVTESWTKEKWSQEFSKHQVLVMTCHVALTVLRNEYLSLSNINLLVFDECHLAIQDHPYREIMKICEDYPSCPRILGLTASILNGKCDPAELEEKIKKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPYTDKSGLYGRLLRELDEALHFLNDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNR"

     misc_feature    497..1090
                     /gene="DICER1"
                     /gene_synonym="dicer"
                     /note="DEXH-box helicase domain of endoribonuclease Dicer;
                     Region: DEXHc_dicer; cd18034"
                     /db_xref="CDD:350792"
     misc_feature    order(497..508,515..517,566..589,710..712,899..901,
                     992..994)
                     /gene="DICER1"
                     /gene_synonym="dicer"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:350792"
     misc_feature    order(674..679,746..751,824..826,830..835,842..844,
                     917..925)
                     /gene="DICER1"
                     /gene_synonym="dicer"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:350792"
     misc_feature    1184..1468
                     /gene="DICER1"
                     /gene_synonym="dicer"
                     /note="Partner-binding domain of the endoribonuclease
                     Dicer; Region: Dicer_PBD; cd15903"
                     /db_xref="CDD:277191"
     misc_feature    order(1199..1204,1211..1213,1217..1222,1397..1402,
                     1409..1414,1421..1423,1430..1435,1442..1444)
                     /gene="DICER1"
                     /gene_synonym="dicer"
                     /note="Trbp binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:277191"
     misc_feature    1487..>1750
                     /gene="DICER1"
                     /gene_synonym="dicer"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
ORIGIN      

gaaggaggaggaggccgtcgcgggcccaggtgaatggaggaacctgacagttggggggagcaaggcggcggcagcggggaaatggcggtggcggcggcagcacaatgagacgcggcctgtagtggggtgcagcgccgggccgggtccgtccgagcaggttacctagggtgaaacaaaattacaggcttggaaactctggaaaagctcagcatcagtatttgagagccgaagcctgcaaattatgtgattaacctacaagctgatatcatgatgtcaaaatgcagtttggaaagcataagcacagaggctgcagagattaaaacgtaggctgtgctggaacaaaaacgcaatgacagaaacactggatgaatgaatgaaaagccctgctttgcaatccctcagcatggcgggactgcagctcatgacccctgcttcctccccaatgggtccattttttggactaccgtggcaacaagaagcaattcatgataacatttatacgccaagaaaatatcaggttgaactgcttgaagcagctttggatcataatacaatagtctgtttaaacactggctcagggaagacttttattgcagtactactcactaaagagctgtcctatcagatcaggggggatttcaacaaaaacggaaaaagaactgtgttcttggtcaactcagcaaatcaagttgctcagcaagtgtcagctgtcaggacacattcagatcttaaagtgggagagtattcaagtttagaggtaactgaatcatggacaaaagagaaatggagtcaggaattctctaagcatcaggttctggttatgacatgtcatgttgctttgactgttttgagaaatgagtatttatccctatcaaatattaatctactggtgtttgatgagtgccatcttgcaatccaggaccatccataccgtgaaattatgaagatctgtgaggattacccatcttgccctcgaatcttgggattaactgcttccattttaaatgggaagtgtgatcctgctgagttagaagaaaagataaagaaactggagaaaatactaaagagcaatgctgaaactgcaactgatttggtggtcttagatagatatacttctcagccatgtgagattgttgtagactgtggaccatatactgacaaaagtggattgtacggaagactattaagggaattagatgaagcacttcattttctaaatgactgcaacatatctgtacattcaaaggaaagagattctacgttaatttctaaacagatattgtcagactgtcgagctgtgttggttgttctgggaccctggtgtgcagataaggtagctgggatgatggtgagagagctacagaagtatatcaaacatgagcaagaggagctgcacaggaaatttttattgtttacagacactttccttaggaaaatacatgcactctgtgaagagcatttctcacctgcctcacttgacctgaaatttgtaactccaaaagtaataaagctgcttgaaatcttgcgcaaatacaaaccatatgaacggcagcagttcgaaagtgttgaatggtataacaatagaaatcaggataattatgtatcatggagtgattctgaagatgatgatgaagatgaagagattgaggagaaagagaagccagagactaatttcccatctccttttacgaatattttatgtggaattatttttgtggaaagaagatacacagcagttgtactaaataggtaa

//