LOCUS       XM_046725382             390 bp    mRNA    linear   INV 14-FEB-2022
DEFINITION  PREDICTED: Haliotis rubra uncharacterized LOC124288830
            (LOC124288830), transcript variant X1, mRNA.
ACCESSION   XM_046725382
VERSION     XM_046725382.1
DBLINK      BioProject: PRJNA801670
KEYWORDS    RefSeq.
SOURCE      Haliotis rubra (blacklip abalone)
  ORGANISM  Haliotis rubra
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Gastropoda;
            Vetigastropoda; Lepetellida; Haliotoidea; Haliotidae; Haliotis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_025767109) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Haliotis rubra Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..390
                     /organism="Haliotis rubra"
                     /mol_type="mRNA"
                     /isolate="DU_JTF1"
                     /isolation_source="Aquaculture farm"
                     /db_xref="taxon:36100"
                     /chromosome="Unknown"
                     /tissue_type="muscle"
                     /dev_stage="adult"
                     /country="Australia: Jade Tiger Abalone Farm, Indented
                     Head, Victoria"
                     /collection_date="2017"
                     /collected_by="Adam Miller"
     gene            1..390
                     /gene="LOC124288830"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 45 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:124288830"
     CDS             11..385
                     /gene="LOC124288830"
                     /codon_start=1
                     /product="uncharacterized protein LOC124288830 isoform X1"
                     /protein_id="XP_046581338.1"
                     /db_xref="GeneID:124288830"
                     /translation="

MDHEYRDQVVKLSQAEDYTAFEDLIQMAGCISMVHTLSRRQEMCKAITKFIVFGRAHQGFDQFCRGLETLGVLGALKHHGTRMKEVFEYEKRLLDSTTIELLFEADLAKANSNRRRQEEIVLSN"

ORIGIN      

aaaccacattatggaccacgaatacagggatcaagtggtgaagttatctcaggccgaggattacacggcctttgaagacctgattcagatggcaggttgtatatccatggtccatacgctgagcaggcgacaagaaatgtgcaaggccataacaaaattcattgtgttcggacgtgcacatcaaggttttgaccaattctgcagaggacttgaaacgcttggcgtattaggagcgctaaaacatcatggaacacgcatgaaagaagtttttgaatatgaaaaaaggcttctggattctacaacaatagaactattgttcgaagcagatttagcaaaggccaactccaaccgacgccgccaagaagagattgttctctcaaactagagaga

//