GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-09-14 06:06:24, GGRNA.v2 : RefSeq release 225 (Jul, 2024)

LOCUS       XM_045755931            1377 bp    mRNA    linear   INV 10-JAN-2022
DEFINITION  PREDICTED: Procambarus clarkii trichohyalin-like (LOC123766652),
            mRNA.
ACCESSION   XM_045755931
VERSION     XM_045755931.1
DBLINK      BioProject: PRJNA793253
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Procambarus clarkii (red swamp crayfish)
  ORGANISM  Procambarus clarkii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
            Pleocyemata; Astacidea; Astacoidea; Cambaridae; Procambarus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_059617) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Procambarus clarkii Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1377
                     /organism="Procambarus clarkii"
                     /mol_type="mRNA"
                     /strain="Jiangsu"
                     /host="Homo sapiens"
                     /db_xref="taxon:6728"
                     /geo_loc_name="China:Nanjing, Hongze Lake"
                     /lat_lon="31.14 N 118.22 E"
                     /collection_date="2018-05-09"
                     /linkage_group="LG47"
     gene            1..1377
                     /gene="LOC123766652"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:123766652"
     CDS             1..1377
                     /gene="LOC123766652"
                     /codon_start=1
                     /product="trichohyalin-like"
                     /protein_id="XP_045611887.1"
                     /db_xref="GeneID:123766652"
                     /translation="
MTSWLYDDFMVQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQRKDELIRTQQHKDEVIRTQQHKDEVIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQRKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQHKDELIRTQQQRTKTQ"
ORIGIN      
atgacttcatggttgtatgatgacttcatggtgcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcattcgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacacaaggatgaggtgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgattcgtacgcagcaacgcaaggatgagctgatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacgcaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctcatccgtacgcagcaacacaaggatgagctgatccgtacgcagcaacagcgtactaaaacacaataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]