LOCUS       XM_045627944             794 bp    mRNA    linear   INV 29-DEC-2021
DEFINITION  PREDICTED: Pieris rapae odorant receptor Or1-like (LOC123689126),
            mRNA.
ACCESSION   XM_045627944
VERSION     XM_045627944.1
DBLINK      BioProject: PRJNA789913
KEYWORDS    RefSeq.
SOURCE      Pieris rapae (cabbage white)
  ORGANISM  Pieris rapae
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata;
            Ditrysia; Papilionoidea; Pieridae; Pierinae; Pieris.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_059512) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Pieris rapae Annotation Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..794
                     /organism="Pieris rapae"
                     /mol_type="mRNA"
                     /db_xref="taxon:64459"
                     /chromosome="4"
     gene            1..794
                     /gene="LOC123689126"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 14 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 1 sample with support for all annotated introns"
                     /db_xref="GeneID:123689126"
     CDS             93..761
                     /gene="LOC123689126"
                     /codon_start=1
                     /product="odorant receptor Or1-like"
                     /protein_id="XP_045483900.1"
                     /db_xref="GeneID:123689126"
                     /translation="

MYEIAYLHQSLSLMLSASMNASKDIVVMALIAQCRCRFRLINIALKGLCRDLHIVNNRLSKKQEEIVTVRLGNFIAEHQDTLETVNELERCFTQPTFAQFTVSLAIICVTAFQLVFQTGNMLRMLSMTFYLLNMVDQVYLYCREGNELTIESENVSRSAYEWPWYTCSVRVRRSTLILMTRCCRTAKLTAGGFTTLSLTTFVSICKASYSFFTVLKQVDEDT"

     misc_feature    <93..719
                     /gene="LOC123689126"
                     /note="7tm Odorant receptor; Region: 7tm_6; pfam02949"
                     /db_xref="CDD:251636"
ORIGIN      

gatatactgttaatcaacacgttaactaatattttattctattcaatatattctaaacccccaggtaccctttcaacgcgtcccagtctccaatgtacgagatcgcctacctacatcagtcgctgtctctaatgctgtcagctagtatgaacgccagcaaagatattgtagtaatggcgcttattgctcaatgtcgctgcagatttcgactcattaacattgcattaaaagggttgtgcagagatttgcatattgttaataaccgtttatctaagaagcaagaagagattgtgacagttcgcctcggtaattttatagctgagcatcaagataccttggagacagtgaatgaactagaacgctgcttcacgcagccgaccttcgcacagttcaccgtatcactagccatcatatgcgtaaccgcctttcagcttgtttttcaaaccggtaatatgcttcgaatgctatctatgaccttctatctcctaaatatggtggaccaagtatacctttactgtcgcgaaggaaacgaacttactattgagagtgaaaacgtgtcacgttctgcgtacgagtggccgtggtatacgtgtagcgtgcgtgtacgtcgatcaacgttgatcctaatgacgcgttgttgccgcaccgccaagctcacagctgggggatttactactctttctcttactacgtttgtgagcatttgcaaagcatcgtattctttctttactgtccttaaacaagtagacgaagacacttaaaaatattataacttatcttaaatttaaatagcg

//