2024-05-19 16:47:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_044259767 1052 bp mRNA linear MAM 13-OCT-2021 DEFINITION PREDICTED: Neovison vison copper chaperone for superoxide dismutase (CCS), transcript variant X4, mRNA. ACCESSION XM_044259767 VERSION XM_044259767.1 DBLINK BioProject: PRJNA769404 KEYWORDS RefSeq. SOURCE Neogale vison (American mink) ORGANISM Neogale vison Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Musteloidea; Mustelidae; Mustelinae; Neogale. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_058097.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Neovison vison Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1052 /organism="Neogale vison" /mol_type="mRNA" /isolate="M4711" /db_xref="taxon:452646" /chromosome="7" /sex="female" /tissue_type="tongue" /dev_stage="mature" gene 1..1052 /gene="CCS" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns" /db_xref="GeneID:122913160" CDS 84..752 /gene="CCS" /codon_start=1 /product="copper chaperone for superoxide dismutase isoform X4" /protein_id="XP_044115702.1" /db_xref="GeneID:122913160" /translation="
MASDSGDGGTACTLEFTVQMTCQSCVDAVRTSLQGVAGKSQNNLRTVRRPLGGAGKPLKPTTLFPFTHVEEHRGRRKERLPSRTETRSQSLEYRSQACQARALYRLWCVLYLRCLGSEELDWAYMGPPPEGVSWIASSCCLRNGIILTKPTAALAMFHPRQLPILMSQLTGLEATLHGQKHLRRQSHQPGPGNRLPLILLNVHPVIQQGTMSMQASLMEEMR"
misc_feature 123..>197 /gene="CCS" /note="copper, zinc superoxide dismutase; Region: PLN02957" /db_xref="CDD:215516" ORIGIN
ctccacctccccgctacgccgttaaggttttgcacttgagccgcggaatagttgaggcctttccgccggtggctgggtccgggatggcttcggactccggggacggcgggaccgcctgcacgttggagttcacagtgcagatgacctgtcagagctgcgtggacgcggtgcgcacgtccctgcaaggggtggcaggtaagagccagaacaacttgcggacagttcggaggcctctaggaggagccggcaaacctcttaaaccaacaacactattcccatttacacatgtggaagaacacagaggtaggaggaaggaacgtcttccgagtcgcacggagacccggagtcagagccttgagtacagatctcaagcctgccaggccagagccctctacaggctctggtgcgtcttatatctcaggtgcctagggagtgaggagctagactgggcatacatgggcccacctccagagggtgtttcctggatagcaagcagctgttgcttgcgaaatggcataatcttgacaaagccaacagcagccctggccatgttccatcctaggcagctcccaattcttatgagccagctaactggtctggaggcgaccttgcacggtcagaaacatctgagaaggcagagccaccagcctggccctgggaaccgcttgcctttgattctgttaaatgttcatccagtcattcagcagggaacgatgagcatgcaagcgtcgctcatggaagagatgaggtgagatggattctaagctgggacagtggtggcacttggccggtacagggcagcgataagggtatgtgacttcaaatccctttctttgcattcacatcccagctttgcctcttagcctcacgtagacgtcatgcatgttactacttttgcctgtttcttctgtgtttaaatggggatgaaaatggaagctaccttggaggattgtcgtgaagagttagttggttaatacctgtaaagcactttattttttgtttaaagattttatttatttgacagacagagatcacaggtaggcagaaaggca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]