2024-04-27 04:13:43, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_043020845 388 bp mRNA linear INV 16-AUG-2021 DEFINITION PREDICTED: Penaeus japonicus uncharacterized LOC122256289 (LOC122256289), mRNA. ACCESSION XM_043020845 VERSION XM_043020845.1 DBLINK BioProject: PRJNA752636 KEYWORDS RefSeq; includes ab initio. SOURCE Penaeus japonicus ORGANISM Penaeus japonicus Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea; Penaeidae; Penaeus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_025031402.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Penaeus japonicus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 9% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..388 /organism="Penaeus japonicus" /mol_type="mRNA" /isolate="Ginoza2017" /db_xref="taxon:27405" /chromosome="Unknown" /country="Japan:Okinawa" /collection_date="2017" gene 1..388 /gene="LOC122256289" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 90% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:122256289" CDS 29..388 /gene="LOC122256289" /codon_start=1 /product="uncharacterized protein LOC122256289" /protein_id="XP_042876779.1" /db_xref="GeneID:122256289" /translation="
MAMQSDAEFFFVGSSVNYTCPEKTMSSDGSTYTTITYNATGWSPIDPNFQCLNICLGDPPTAPPFVSSDFAGARAWGTVVTYTCQFAFRGAGAEVTVTCDEGSWWPNSLPACIGIIRGR"
misc_feature <50..367 /gene="LOC122256289" /note="secreted complement-binding protein; Provisional; Region: PHA02927" /db_xref="CDD:222943" ORIGIN
ccctcctccgccacctccgtcaggcatcatggccatgcagtcggacgctgaattcttcttcgtcggttcttccgtcaactacacatgccccgaaaagaccatgtcctccgacggctctacctacacgacaattacttacaatgccacaggctggtccccgatcgatcccaatttccaatgtttgaacatatgccttggagacccgcccacagcgccgcccttcgtcagcagcgacttcgccggagcgagggcgtggggaaccgtggtcacctacacctgccagtttgcgttccggggagcaggagccgaggtcacggtgacctgcgacgagggatcctggtggcccaactctctccccgcctgcataggaataattagaggcagatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]