2024-05-20 08:27:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_042755111 1140 bp mRNA linear VRT 27-JUL-2021 DEFINITION PREDICTED: Cyprinus carpio alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5-like (LOC109104697), transcript variant X2, mRNA. ACCESSION XM_042755111 VERSION XM_042755111.1 DBLINK BioProject: PRJNA745992 KEYWORDS RefSeq. SOURCE Cyprinus carpio (common carp) ORGANISM Cyprinus carpio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Cyprininae; Cyprinus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024879268.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Cyprinus carpio Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1140 /organism="Cyprinus carpio" /mol_type="mRNA" /isolate="SPL01" /db_xref="taxon:7962" /chromosome="Unknown" /tissue_type="muscle" /dev_stage="adult" gene 1..1140 /gene="LOC109104697" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 21 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 21 samples with support for all annotated introns" /db_xref="GeneID:109104697" CDS 143..874 /gene="LOC109104697" /codon_start=1 /product="alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5-like isoform X2" /protein_id="XP_042611045.1" /db_xref="GeneID:109104697" /translation="
MHCKSCALVTSSGHMTGSGRGAEIDRKECVIRMNDAPTRGYQRDVGQRTSLRVVAHSSMQRVLRNRLELLNSSQNTFFIFWGPGNYMRQDGKGLVYNNLRLLKQMMPKLQVYVISRLKMLHFDELFKKETGKDRKRSNSWLSTGWFTMAIAVEICDRIDVYGMISPEFCKSPNLEPSVPYHYYEPAGPDECKMYLSHEQGRYGSHHRFITEKRVFANWALMFNIHFYQPDWRPAPVTKNSTDS"
misc_feature 146..787 /gene="LOC109104697" /note="Glycosyltransferase family 29 (sialyltransferase); Region: Glyco_transf_29; pfam00777" /db_xref="CDD:425864" ORIGIN
cagcagttttactgagacaccagaagatcagatgcagtcaggtggacatcagatggatgttatacaacagcaaacatcccacttagaaggttacagcagcatcgctgatcataaggtgacttgttttcattagcctcttaggatgcattgcaaaagctgtgccttagtgactagctctggtcacatgactggaagtggtcgaggtgcggagattgaccgcaaggagtgcgtcatccgtatgaatgatgccccaacacgaggctaccagagggacgtgggccagcgaacgagtctgcgtgtggtcgcacactccagcatgcaacgtgtgctacgaaaccgccttgaactactcaactccagccagaacaccttctttatcttctgggggcctggaaactacatgcgacaagatggtaaaggccttgtctacaacaacctgcgtctgctgaagcagatgatgcctaaactacaggtgtacgtcatctcgaggttaaagatgctgcattttgatgagctctttaagaaggaaacagggaaagatagaaaaaggtccaattcatggctcagcactggttggttcactatggcgatcgctgtggagatttgtgacagaatcgacgtctatggaatgatttctcctgagttctgcaagtcacctaacctcgagccatcagtgccgtatcactactacgagcctgcggggccagatgaatgtaaaatgtatctctctcacgagcagggccggtacggcagccaccatcgtttcattactgagaaacgtgtctttgccaactgggcacttatgttcaacatacacttctatcaaccagactggagaccggcacctgttacaaaaaacagcacagactcctgaggttcaaacactggggtgtttctccgactcagaacctctgtgtccttttgaggacaaaacttgaacatttgaactggaacacattatgaatgaaagttttgaaacaacaaggtctaattttgctgaacattttaattgcaaaagctgtgctgaacaaaaatgttcaaagattatgttcagtgtgacaagaacaaacagtttattattcacattacttattaattgaaacagtatgatcctcattggttcgtaattcagaaaactgg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]