2024-05-05 22:30:19, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_042366601 735 bp mRNA linear INV 16-JUL-2021 DEFINITION PREDICTED: Homarus americanus uncharacterized LOC121866866 (LOC121866866), mRNA. ACCESSION XM_042366601 VERSION XM_042366601.1 DBLINK BioProject: PRJNA744898 KEYWORDS RefSeq; includes ab initio. SOURCE Homarus americanus (American lobster) ORGANISM Homarus americanus Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea; Nephropoidea; Nephropidae; Homarus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024729998.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Homarus americanus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..735 /organism="Homarus americanus" /mol_type="mRNA" /isolate="GMGI-L3" /isolation_source="marine" /db_xref="taxon:6706" /chromosome="Unknown" /sex="male" /tissue_type="heart & testis" /country="USA: Gloucester, Massachusetts" /collection_date="2015" gene 1..735 /gene="LOC121866866" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:121866866" CDS 1..735 /gene="LOC121866866" /codon_start=1 /product="uncharacterized protein LOC121866866" /protein_id="XP_042222535.1" /db_xref="GeneID:121866866" /translation="
MITRESLGVSMIICESLGVIMITRESLGVIMITRESLGVIMIICESLGVIMIICESLGVIMNICESLSVIMITRESLGVIMIICESLGVIMNICESLSVIMITRESLGVIMIICESLGVIMNICESLSVIMITRESLGVIMITRESLGVIMIICESLSVIMITRESLGVIMNICESLSVIMITRESLGVIMITRESLGVIMITRESLGVIMITRESLGVIMITRESLSFYHMVLLPPLSHSVSL"
ORIGIN
atgatcacccgtgagtcacttggtgtcagtatgatcatctgtgagtcactcggtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcacttggtgtcattatgatcatctgtgagtcactcggtgtcattatgatcatctgtgagtcactcggtgtcattatgaacatctgtgagtcactcagtgtcattatgatcacccgtgagtcactcggtgtcattatgatcatctgtgagtcactcggtgtcattatgaacatctgtgagtcactcagtgtcattatgatcacccgtgagtcactcggcgtcattatgatcatctgtgagtcactcggtgtcattatgaacatctgtgagtcactcagtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcacttggtgtcattatgatcatctgtgagtcactcagtgtcattatgatcacccgtgagtcacttggtgtcattatgaacatctgtgagtcactcagtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcactcggtgtcattatgatcacccgtgagtcactgagtttttatcacatggtgctattaccacctttgagtcactcggtgtcattatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]