2024-03-29 16:45:22, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_042070776 713 bp mRNA linear VRT 14-JUN-2021 DEFINITION PREDICTED: Alosa sapidissima cold-inducible RNA-binding protein B-like (LOC121690282), transcript variant X2, mRNA. ACCESSION XM_042070776 VERSION XM_042070776.1 DBLINK BioProject: PRJNA736150 KEYWORDS RefSeq. SOURCE Alosa sapidissima (American shad) ORGANISM Alosa sapidissima Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Clupei; Clupeiformes; Clupeoidei; Clupeidae; Alosa. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_055974.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Alosa sapidissima Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..713 /organism="Alosa sapidissima" /mol_type="mRNA" /isolate="fAloSap1" /specimen_voucher="AsapiF_1" /db_xref="taxon:34773" /chromosome="18" /sex="male" /tissue_type="muscle" /dev_stage="adult" /country="USA: St. Johns River, Florida" /lat_lon="28.438892 N 81.894728 W" /collection_date="2020-02-07" /collected_by="Reid Hyle" gene 1..713 /gene="LOC121690282" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns" /db_xref="GeneID:121690282" CDS 77..421 /gene="LOC121690282" /codon_start=1 /product="cold-inducible RNA-binding protein B-like isoform X2" /protein_id="XP_041926710.1" /db_xref="GeneID:121690282" /translation="
MSDEGKLFVGGLSFDTTEQSLEEAFTKFGVITNVHVARNRDTQQSRGFGFVTFDNPDDAKEAMDGMNGQSVDGRTIRVDKAGKPGGGGGGGGGYRGGGGGGYGGGGYGGGGGGW"
misc_feature 89..325 /gene="LOC121690282" /note="RNA recognition motif (RRM) superfamily; Region: RRM_SF; cl17169" /db_xref="CDD:450164" polyA_site 713 /gene="LOC121690282" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
tcacgagccccggattgaggcgcacatcacgaagaacagcctttgctcttcagcacacgaggcgtacagcagcaaaatgtctgacgagggaaaactgttcgtcggtggacttagcttcgacacaacggagcagtcccttgaagaagctttcactaagtttggggttatcacaaacgttcacgttgccagaaatcgggacactcagcaatcgcgtggctttggtttcgtcacattcgataacccggacgatgcaaaagaggccatggatggaatgaatggacagtctgtcgacggcagaacgatccgcgtggacaaggccggaaagcctggtggtggcggaggcggcggcggcggctaccgtggcggcggaggcggtggatacggcggtggcggatacggcggcggcggaggaggctggtgatcgtggataggccctaatgctgaccaaaaacatccaggcacatcttactgcaccgcagcgcaacctttaaagcaggatgcagtaagaagaacgctgaccaatctcttcttggactgtaatacacataactccgcgtaagcgtccctggataaataaattaatcttgtaaatgagatgcttgttcttcaaacgttcctcagggatcacattttccatgaacaggaaatgagccctggtctgttatataatgcaatgtgatgtgaaaatggatcaaaataaatactaaaagtta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]