GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-16 14:37:45, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_041684881             240 bp    mRNA    linear   PLN 22-FEB-2025
DEFINITION  Aspergillus luchuensis uncharacterized protein (AKAW2_20194A),
            partial mRNA.
ACCESSION   XM_041684881
VERSION     XM_041684881.1
DBLINK      BioProject: PRJNA727292
            BioSample: SAMD00269936
            Sequence Read Archive: DRR262015, DRR262016, DRR262017
KEYWORDS    RefSeq.
SOURCE      Aspergillus luchuensis
  ORGANISM  Aspergillus luchuensis
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus; Aspergillus subgen. Circumdati.
REFERENCE   1
  AUTHORS   Mori,K., Kadooka,C., Goto,M. and Futagami,T.
  TITLE     Aspergillus luchuensis mut. kawachii IFO 4304 genome sequence
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 240)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-FEB-2025) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 240)
  AUTHORS   Kazuki,M. and Futagami,T.
  CONSRTM   Aspergillus luchuensis mut. kawachii IFO 4304 genome sequencing
            consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2021) Contact:Taiki Futagami Kagoshima
            University, Agriculture; Korimoto 1-21-24, Kagoshima, Kagoshima
            890-0065, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_054850).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..240
                     /organism="Aspergillus luchuensis"
                     /mol_type="mRNA"
                     /strain="IFO 4308"
                     /db_xref="taxon:1069201"
                     /chromosome="2"
                     /geo_loc_name="Japan"
     gene            <1..>240
                     /locus_tag="AKAW2_20194A"
                     /db_xref="GeneID:64956579"
     CDS             1..240
                     /locus_tag="AKAW2_20194A"
                     /note="COG:S;
                     EggNog:ENOG410PTK3;
                     InterPro:IPR010580;
                     PFAM:PF06624;
                     TransMembrane:1 (i42-63o);
                     go_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_041539020.1"
                     /db_xref="GeneID:64956579"
                     /translation="
MAQTPQQRKANERFAKQESAKRGKGKTVVKSKQTPRSPVSTVWVAILAFVVCGGIFLEVLGIVPKLWSTVVASVSRLIL"
     misc_feature    4..180
                     /locus_tag="AKAW2_20194A"
                     /note="Ribosome associated membrane protein RAMP4; Region:
                     RAMP4; pfam06624"
                     /db_xref="CDD:461965"
ORIGIN      
atggctcaaactccccagcaaaggaaggccaacgaaaggttcgcgaagcaggaatctgcaaagcgtggtaaaggcaagacagttgtcaagtcaaagcagactccaaggtcgcctgtgtccactgtgtgggtggccattctcgcgttcgttgtctgtggaggaatcttccttgaagttctagggatcgtaccgaagctttggtccaccgtggtcgcaagcgtcagccgcttaatactttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]