GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 08:27:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_041428279             726 bp    mRNA    linear   PLN 15-SEP-2021
DEFINITION  Suillus discolor cyclophilin-like domain-containing protein
            (F5147DRAFT_148620), mRNA.
ACCESSION   XM_041428279
VERSION     XM_041428279.1
DBLINK      BioProject: PRJNA727289
            BioSample: SAMN12812516
KEYWORDS    RefSeq.
SOURCE      Suillus discolor
  ORGANISM  Suillus discolor
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Agaricomycetes; Agaricomycetidae; Boletales; Suillineae;
            Suillaceae; Suillus.
REFERENCE   1  (bases 1 to 726)
  AUTHORS   Lofgren,L.A., Nguyen,N.H., Vilgalys,R., Ruytinx,J., Liao,H.L.,
            Branco,S., Kuo,A., LaButti,K., Lipzen,A., Andreopoulos,W.,
            Pangilinan,J., Riley,R., Hundley,H., Na,H., Barry,K.,
            Grigoriev,I.V., Stajich,J.E. and Kennedy,P.G.
  TITLE     Comparative genomics reveals dynamic genome evolution in host
            specialist ectomycorrhizal fungi
  JOURNAL   New Phytol (2020) In press
   PUBMED   33355923
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 726)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 726)
  AUTHORS   Kuo,A., Lofgren,L.A., Vilgalys,R., Nguyen,N.H., Ruytinx,J.,
            Liao,H.-L., Branco,S., LaButti,K., Lipzen,A., Andreopoulos,W.,
            Pangilinan,J., Riley,R., Hundley,H., Na,H., Grigoriev,I., Barry,K.,
            Stajich,J.E. and Kennedy,P.G.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2020) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_024541270).
            
            ##Metadata-START##
            Organism Display Name :: Suillus discolor FC423 v1.0
            GOLD Stamp ID         :: Gp0305074
            ##Metadata-END##
FEATURES             Location/Qualifiers
     source          1..726
                     /organism="Suillus discolor"
                     /mol_type="mRNA"
                     /strain="FC423"
                     /db_xref="taxon:1912936"
                     /chromosome="Unknown"
     gene            1..726
                     /locus_tag="F5147DRAFT_148620"
                     /db_xref="GeneID:64690538"
     CDS             99..398
                     /locus_tag="F5147DRAFT_148620"
                     /codon_start=1
                     /product="cyclophilin-like domain-containing protein"
                     /protein_id="XP_041293620.1"
                     /db_xref="GeneID:64690538"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="JGIDB:Suidis1_148620"
                     /translation="
MALPTNGRVIIDITAGEIEIELWSKETPRTCRNFIALALEGYYDGVIFHRIVPGFLVQTGDKTGTGGGGESFYGAKRCGCPLIPHPNSVDIASTSRWKA"
     misc_feature    108..>323
                     /locus_tag="F5147DRAFT_148620"
                     /note="cyclophilin-type peptidylprolyl cis- trans
                     isomerases. This family contains eukaryotic, bacterial and
                     archeal proteins which exhibit a peptidylprolyl cis- trans
                     isomerases activity (PPIase, Rotamase) and in addition
                     bind the immunosuppressive drug...; Region: cyclophilin;
                     cl00197"
                     /db_xref="CDD:444740"
ORIGIN      
taacaaattcaccgagtcttaccagttgaattccctttgtagggttgtccacttagcacgccgaccagaacttcacttgacctcactcgcaaacagcaatggcactcccaacaaatgggcgagtgataatcgacataactgcaggagaaattgaaattgaactatggtcaaaggaaacaccaagaacatgccggaacttcatcgcactcgcgctagaaggttattatgatggcgtcatctttcacagaatcgtcccgggtttcttagtccaaaccggcgacaaaacagggacaggtggaggaggggagtcattctatggagcgaaacgttgtggttgtcctcttatccctcatccaaattccgttgatatcgcctctacatcacgatggaaggcctagaggacatctggaagagatatccagctttcaggatagcagaccgaccgacctttattgtcgcggggtgaaaaacactggatatcaacacggtgaagaagtggatcaaactgtgccatgcgagccatggagatacatgtaaagtctcaagagtaggcgaacacgacaagaggaaactgccggggtttgtgagagtggtggacatagtattgatggccgtggttcctgcgccttctggttgtcgttacatcgcccccagttacatgtggggaggcatcggcgcagagtgtattggacgacgaaggataatatagcagagcgcggcacgcct
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]