2024-05-19 00:38:19, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_041402310 1449 bp mRNA linear VRT 05-MAY-2021 DEFINITION PREDICTED: Onychostruthus taczanowskii homeobox B8 (HOXB8), transcript variant X2, mRNA. ACCESSION XM_041402310 VERSION XM_041402310.1 DBLINK BioProject: PRJNA703052 KEYWORDS RefSeq. SOURCE Onychostruthus taczanowskii (white-rumped snowfinch) ORGANISM Onychostruthus taczanowskii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Passeriformes; Passeroidea; Passeridae; Onychostruthus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024499206.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Onychostruthus taczanowskii Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1449 /organism="Onychostruthus taczanowskii" /mol_type="mRNA" /isolate="IOZ18803" /db_xref="taxon:356909" /chromosome="Unknown" /sex="pooled male and female" /tissue_type="blood" /altitude="4200 m" gene 1..1449 /gene="HOXB8" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 18 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:121334817" CDS 36..761 /gene="HOXB8" /codon_start=1 /product="homeobox protein Hox-B8 isoform X2" /protein_id="XP_041258244.1" /db_xref="GeneID:121334817" /translation="
MSSYFVNSLFSKYKTGDSLRPNYYDCGFAQDLGGRPTVVYGASAGGTFQPPPQIQEFYHGASSLSSSPYQQNPCAVACHGEPGSFYGYEPLQRQSVFGPQEPELLQYADCKLAASGLGEEAESSEQSPSPTQLFPWMRPQAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEADEEGEAQKADKK"
misc_feature order(468..482,486..488,537..539,555..557,594..596, 600..605,612..617,621..629,633..638) /gene="HOXB8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(474..476,483..485,603..605,612..617,624..626) /gene="HOXB8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 477..635 /gene="HOXB8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" ORIGIN
aaaaaaaagaacaacaacctcttattgaaattaaaatgagctcctattttgtcaactcactcttctccaaatacaaaaccggcgactccctgcgccccaattactacgactgcggcttcgcccaggatctggggggcagacccaccgtggtgtacggagccagcgccgggggcaccttccagccccctccccaaatccaggagttctaccacggcgcctcgtcgctctccagctccccttaccagcagaacccgtgcgccgtggcttgccatggggagccgggcagcttctacggctacgagcccctgcagcggcagagcgtgttcgggccgcaggagcccgagctgctgcagtacgcggactgcaagctggcggccagcggcctcggcgaggaggcggagagctccgagcagagcccttctcccacccagcttttcccctggatgcgaccgcaagccgccggacgcaggagggggaggcaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaagcggaggatcgaggtctcgcacgccctgggcttgacagagaggcaggtcaaaatctggttccagaacaggaggatgaagtggaaaaaggagaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggcggacgaggaaggggaagcacagaaggcggacaagaaataaagggatttttttttttttgaggactgaaaggcaagcgctgctggggtggaagagccccccgagccccgcgttaatggcagtcggtgtaagggaggggtgggctgggggggacacacaaaaaaaaaaaacaacaaaccagaaaaacaaagcctagaaaatacaaaaaaaaaaaaagaaaaaccacaaaaaaaaacccacaaaaaaccccaagaaaaccgaccccttttattgctgtaaaacaatatagctgcgagcgccactttcgcgattctcctttgacacaaagcaggaggcgggggggctccgggagctctgggcccccttttgccagttattaactagcggtagtggaacgcaatagcttctgtaaaacatgactgtgaaatcctctccctctctgtctttctctctcttctttccgggggcgtggggggtgggttggttaacatagctttcagcgctagaggagttatgtgatattacatttgtgcactttttttttgttggttttttttttaaattttgggtctctagttggttatttccccattcctgttttttttttttttattattattatttttgttgtggtttatctgtgtgtactggaggtagctgttgagacaaacatcccaacaacatgaaactgcctatttatgctgtagttatctctctttctctctcttca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]