2024-05-20 10:23:26, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_041010862 654 bp mRNA linear PLN 19-APR-2021 DEFINITION PREDICTED: Glycine max uncharacterized LOC100306572 (LOC100306572), transcript variant X2, mRNA. ACCESSION XM_041010862 VERSION XM_041010862.1 DBLINK BioProject: PRJNA48389 KEYWORDS RefSeq. SOURCE Glycine max (soybean) ORGANISM Glycine max Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Phaseoleae; Glycine; Glycine subgen. Soja. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_038253.2) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Glycine max Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..654 /organism="Glycine max" /mol_type="mRNA" /cultivar="Williams 82" /db_xref="taxon:3847" /chromosome="17" /tissue_type="callus" gene 1..654 /gene="LOC100306572" /note="uncharacterized LOC100306572; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 ESTs, 11 long SRA reads, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:100306572" CDS 170..520 /gene="LOC100306572" /codon_start=1 /product="uncharacterized protein LOC100306572 isoform X2" /protein_id="XP_040866796.1" /db_xref="GeneID:100306572" /translation="
MAGPFELGSSKKKPGDGVNDLLTFNAENMQSNMKIIYYSRTFLSIIGGVVAGILGFTSLKGFVFYFLLMMVTSLGLVAKARFSIHSYFDSSNRVLLDGFLGGLMSFVLFWTYPSLL"
misc_feature 272..502 /gene="LOC100306572" /note="Rab5-interacting protein (Rab5ip); Region: Rab5ip; pfam07019" /db_xref="CDD:429250" ORIGIN
ctttgaccgcttatatatacgcacgaatcacaaatcgtaacattggcatgaacgataacactgaactagctctcacgtttgtgcttgcacttgcacctctccaacgataacaacgacgagcacaagatccagttacatattattcgagtagacaaggcaggcacatagtatggctggaccttttgagttgggttcatcaaagaagaaaccaggggatggagtgaatgatttactcacttttaatgctgaaaatatgcaaagcaacatgaaaattatttattacagccgaacatttttgtctataattggtggagttgttgctggaattttggggttcacaagcttgaaaggatttgtattttacttccttctcatgatggttacttcacttgggcttgtagccaaagccagattttcaatccactcctactttgactcctcgaatcgagttctacttgatggcttcctaggtggtctaatgtcattcgtgctgttctggacgtatccttctcttttataatacttgttgatctccaggagaatattcttgaagcttttttctccagagcttattattgaagatctttgttttgtaagatagagtgaattgctcttctaaaaaaaaatatatatgatagattgcaatttaccaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]