LOCUS       XM_040771236             480 bp    mRNA    linear   PLN 21-APR-2021
DEFINITION  Dacryopinax primogenitus uncharacterized protein
            (DACRYDRAFT_16881), partial mRNA.
ACCESSION   XM_040771236
VERSION     XM_040771236.1
DBLINK      BioProject: PRJNA721985
            BioSample: SAMN02981302
KEYWORDS    RefSeq.
SOURCE      Dacryopinax primogenitus
  ORGANISM  Dacryopinax primogenitus
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Dacrymycetes; Dacrymycetales; Dacrymycetaceae; Dacryopinax.
REFERENCE   1  (bases 1 to 480)
  AUTHORS   Floudas,D., Binder,M., Riley,R., Barry,K., Blanchette,R.A.,
            Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W.,
            Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A.,
            Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B.,
            Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C.,
            Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A.,
            Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F.,
            Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R.,
            McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G.,
            Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J.,
            Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St
            John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A.,
            Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F.,
            Cullen,D., Grigoriev,I.V. and Hibbett,D.S.
  TITLE     The Paleozoic origin of enzymatic lignin decomposition
            reconstructed from 31 fungal genomes
  JOURNAL   Science 336 (6089), 1715-1719 (2012)
   PUBMED   22745431
REFERENCE   2  (bases 1 to 480)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 480)
  AUTHORS   Riley,R., Floudas,D., Binder,M., Barry,K., Blanchette,R.A.,
            Henrissat,B., Martinez,A.T., Otillar,R., Spatafora,J.W.,
            Yadav,J.S., Aerts,A., Benoit,I., Boyd,A., Carlson,A., Copeland,A.,
            Coutinho,P.M., de Vries,R.P., Ferreira,P., Findley,K., Foster,B.,
            Gaskell,J., Glotzer,D., Gorecki,P., Heitman,J., Hesse,C., Hori,C.,
            Igarashi,K., Jurgens,J.A., Kallen,N., Kersten,P., Kohler,A.,
            Kues,U., Kumar,T.K., Kuo,A., LaButti,K., Larrondo,L.F.,
            Lindquist,E., Ling,A., Lombard,V., Lucas,S., Lundell,T., Martin,R.,
            McLaughlin,D.J., Morgenstern,I., Morin,E., Murat,C., Nagy,L.G.,
            Nolan,M., Ohm,R.A., Patyshakuliyeva,A., Rokas,A., Ruiz-Duenas,F.J.,
            Sabat,G., Salamov,A., Samejima,M., Schmutz,J., Slot,J.C., St.
            John,F., Stenlid,J., Sun,H., Sun,S., Syed,K., Tsang,A.,
            Wiebenga,A., Young,D., Pisabarro,A., Eastwood,D.C., Martin,F.,
            Cullen,D., Hibbett,D.S. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAY-2012) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_024467210).
            
            ##Metadata-START##
            Organism Display Name :: Dacryopinax sp. DJM 731 SSP1
            GOLD Stamp ID         :: null
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..480
                     /organism="Dacryopinax primogenitus"
                     /mol_type="mRNA"
                     /strain="DJM-731 SS1"
                     /type_material="type material of Dacryopinax primogenitus"
                     /db_xref="taxon:1858805"
                     /chromosome="Unknown"
     gene            <1..>480
                     /locus_tag="DACRYDRAFT_16881"
                     /db_xref="GeneID:63686298"
     CDS             1..480
                     /locus_tag="DACRYDRAFT_16881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_040627306.1"
                     /db_xref="GeneID:63686298"
                     /db_xref="JGIDB:Dacsp1_16881"
                     /translation="

MSLTVTCKALLLDSVPFHFQLANWAQITVLRAILQYQKDKEKQMVLNPFTGKAESVPPLSNYWNWIHCIWKAKRQLYLESADEEAVKEAVGEVYKWQAETTTMGLSRGQVLEQDATGPATGEGEEDGSYYDEGDEGDEVDEVDEVDEVDEVDEVGENED"

ORIGIN      

atgagcctcacagtgacttgcaaagccttgcttctggacagtgtgccttttcacttccaactggcaaactgggctcagatcactgtgctgagggcaatccttcaataccaaaaagacaaagagaagcagatggtgctgaacccattcactggtaaagctgagagtgtgcccccactgtcaaactactggaactggatccattgtatctggaaggccaagagacaattgtatctggagtctgcagatgaagaggcagtcaaggaggcagtgggggaggtgtataagtggcaggcagagacaaccaccatggggttgtccagagggcaggtccttgagcaggatgccactgggcctgcaactggggagggtgaagaagatggatcatattatgatgaaggggatgaaggggatgaggtggatgaggtggatgaggtggatgaggtggatgaggtggatgaggtgggtgaaaatgaggattga

//