2024-04-20 14:16:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_040109658 1828 bp mRNA linear INV 18-MAR-2021 DEFINITION PREDICTED: Bactrocera tryoni mitochondrial pyruvate carrier 2-like (LOC120777994), transcript variant X2, mRNA. ACCESSION XM_040109658 VERSION XM_040109658.1 DBLINK BioProject: PRJNA695304 KEYWORDS RefSeq. SOURCE Bactrocera tryoni ORGANISM Bactrocera tryoni Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Tephritoidea; Tephritidae; Bactrocera; Bactrocera. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052499.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Bactrocera tryoni Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1828 /organism="Bactrocera tryoni" /mol_type="mRNA" /isolate="S06" /isolation_source="lab stock" /db_xref="taxon:59916" /chromosome="1" /sex="male" /tissue_type="Whole body" /dev_stage="adult" /country="Australia: Sydney" /collection_date="2006" gene 1..1828 /gene="LOC120777994" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns" /db_xref="GeneID:120777994" CDS 198..659 /gene="LOC120777994" /codon_start=1 /product="mitochondrial pyruvate carrier 2-like" /protein_id="XP_039965592.1" /db_xref="GeneID:120777994" /translation="
MASSAPPAAAPPPPPPPSATTAGKGFPNKIYNALIGSVDKHVPEKLRPLWQHPAGPKTVFFWAPLFKWSLVIAGLSDLARPAETLSVPQCAALAATGIIWSRYSLVIIPKNYSLFAVNLFVGLTQVVQLGRAYNYQMEQNKLAGEQPAKKNEL"
misc_feature 330..656 /gene="LOC120777994" /note="Uncharacterized protein family (UPF0041); Region: MPC; pfam03650" /db_xref="CDD:427425" ORIGIN
tggatgttgtgctggaatttcttcactatctagcaaacggtgaggaagtcaacaccagtaattgttcaagtaaggtaccttgtataccttgcctttagaataaagttagaaaattgtaaatacgagaaactagtacaaaatatctaatctcaaacgaaacaaaaatctgaaataagtgcttagaaaacaacaataaaatggcttcctcagcacctccagcagcagcaccaccaccaccacctccgccatcagccactaccgctggcaaaggatttcccaacaaaatttacaatgctcttattggctcagtggacaaacatgtgcccgaaaagttgcgaccattgtggcagcatccagcaggaccaaaaactgttttcttctgggcaccacttttcaaatggtctcttgtcatagctggtctcagcgacttggcgcgtccggctgaaactctttcggtgccccagtgtgcagcactcgccgccaccggtatcatttggtcacgttactccttggttatcattcccaaaaactacagtctgttcgccgtcaatttatttgtcggtttgacacaagtcgttcaactgggccgcgcatacaattaccaaatggaacagaacaaactggctggtgaacaacctgcgaagaagaacgaattgtaaatggctttaatttcgatttgtatataatattcaaatgtttgtatatacacatgtatataatgttaatgagacgcatgctacctacattaattatgcgatcacttttcaatattttctgttcttacatactatttatgaatatgtatacaatccactttacatacatatatgagtgataaaaaggtaattacggccaaaaaacacatcaggcggtggcggtaataaaataaaaataaatagagcaagcgcaaagctcttacatatatatgtatattatacatttgtatgtatgtatgtatatttgtatacccacgtgcataagcaagttactaattgcacttgaatgcaaaatgtcaatgtcaatgccgcaacattcacttgactccactcattcacaaaaatatacacacatacttacatatgtaaatgacttagccaaacaacaaaaccattggccagtaaaagtgctcaatatgccgaagcagtcatttattattatataatagtactacaaaaactggtgatataattaagtagtgaattgtaaattaaataatattatcatgttcgattatactgaagctgaattaattttgaatttaaactataactaagttaagaaagttaatcaaaaagaccatcacaaaacagcacaaaatatgcaaataaaaaggtataaaacacaatttgtacaaaagcttcccaatgaaagtgaaattgttttttctttcttttaatcttttgttaataacatcaaactattgcatattaaatagcaatttttttctcgtttaatcaatttgtcaatgcagaccttaacacacatgccaaagagtttaaagtttgtgtttccatcaataataaagaactggtttgagcaaaagaaaaaacgaaaaagatacatatgacatttacatactaatatttatgtacatatgtacataagtcgtaagaggctgcacaaattacatagcatagcaaagtacccaattagcatctaacatggaaacagccatatgtagataaatgtgttaattatatgtacatacatatgtattttaggcaatgagaacttttgtttgtagaattacgagtaaaagttaaaaaaaaaactttttgcatgtgtactttaagtctcaataaagaaacgaacgaaacgagtttacgtg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]