2024-04-26 09:34:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039860438 750 bp mRNA linear MAM 02-MAR-2021 DEFINITION PREDICTED: Pteropus giganteus ubiquinol-cytochrome-c reductase complex assembly factor 3 (LOC120600850), mRNA. ACCESSION XM_039860438 VERSION XM_039860438.1 DBLINK BioProject: PRJNA703023 KEYWORDS RefSeq. SOURCE Pteropus giganteus (Indian flying fox) ORGANISM Pteropus giganteus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Megachiroptera; Pteropodidae; Pteropodinae; Pteropus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024356248.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Pteropus giganteus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..750 /organism="Pteropus giganteus" /mol_type="mRNA" /isolation_source="ENVO:00010625" /db_xref="taxon:143291" /chromosome="Unknown" gene 1..750 /gene="LOC120600850" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 104 samples with support for all annotated introns" /db_xref="GeneID:120600850" CDS 149..532 /gene="LOC120600850" /codon_start=1 /product="ubiquinol-cytochrome-c reductase complex assembly factor 3" /protein_id="XP_039716372.1" /db_xref="GeneID:120600850" /translation="
MVSSVGRSGPCREAVRRGGCLSRLRGTAEGASPVARRTMQAFRKALIVGAVLGAGAGVGSALFVLVTPREERIQAMLKEMPGQDPRSREQAARNKQLVLATLQEAAATQENLAWRKKWMGSGGGRSA"
misc_feature 263..523 /gene="LOC120600850" /note="Domain of unknown function (DUF4574); Region: DUF4574; pfam15141" /db_xref="CDD:434494" ORIGIN
ttcacgacaatgggctccgtgctcggtcctccttgccaacacttccttgacatgctcaaccgtctcgtccaaatctagatataaaacgcaggtgctctagattccaaacgttccgcagattaggccctctctagcccttcccttctctatggtgtcctctgtgggtcgctctggcccgtgcagggaggcggtgagacgcggtggctgcctttctaggctgcgggggacggcagagggcgcctcgccggttgcgcggcggaccatgcaggcctttcgcaaagcgctgatcgtaggcgcagtgctgggcgcgggggctggcgttggctccgcgctctttgtcctcgtgaccccgagagaggagcggattcaggcgatgctgaaggagatgccggggcaggacccgcggagcagggagcaggcggccaggaacaaacagttagtgctagctactctgcaggaggcagcggccacgcaggagaacttggcctggaggaagaaatggatgggcagcggcggcgggaggtcagcgtgacctgggacctgcccctgtgggcgctgggacctgccttcccgcgcaggagtcggaggcggcctttaaagaatggacctggcggggagtccgggtccggggagccgccgttccgctcaaaccctgcactgacggcgctttcacgttcgcatggcgggcccgcaccatcggatgctgccaattgaggaaatcaataaatcacgttcctccatcgagaatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]