GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-23 08:03:35, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_039860438             750 bp    mRNA    linear   MAM 02-MAR-2021
DEFINITION  PREDICTED: Pteropus giganteus ubiquinol-cytochrome-c reductase
            complex assembly factor 3 (LOC120600850), mRNA.
ACCESSION   XM_039860438
VERSION     XM_039860438.1
DBLINK      BioProject: PRJNA703023
KEYWORDS    RefSeq.
SOURCE      Pteropus vampyrus (large flying fox)
  ORGANISM  Pteropus vampyrus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Chiroptera; Yinpterochiroptera;
            Pteropodoidea; Pteropodidae; Pteropodinae; Pteropus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024356248.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Pteropus giganteus Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..750
                     /organism="Pteropus vampyrus"
                     /mol_type="mRNA"
                     /isolation_source="ENVO:00010625"
                     /db_xref="taxon:132908"
                     /chromosome="Unknown"
     gene            1..750
                     /gene="LOC120600850"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 104 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:120600850"
     CDS             149..532
                     /gene="LOC120600850"
                     /codon_start=1
                     /product="ubiquinol-cytochrome-c reductase complex
                     assembly factor 3"
                     /protein_id="XP_039716372.1"
                     /db_xref="GeneID:120600850"
                     /translation="
MVSSVGRSGPCREAVRRGGCLSRLRGTAEGASPVARRTMQAFRKALIVGAVLGAGAGVGSALFVLVTPREERIQAMLKEMPGQDPRSREQAARNKQLVLATLQEAAATQENLAWRKKWMGSGGGRSA"
     misc_feature    263..523
                     /gene="LOC120600850"
                     /note="Ubiquinol-cytochrome-c reductase complex assembly
                     factor 3; Region: UQCC3; pfam15141"
                     /db_xref="CDD:464526"
ORIGIN      
ttcacgacaatgggctccgtgctcggtcctccttgccaacacttccttgacatgctcaaccgtctcgtccaaatctagatataaaacgcaggtgctctagattccaaacgttccgcagattaggccctctctagcccttcccttctctatggtgtcctctgtgggtcgctctggcccgtgcagggaggcggtgagacgcggtggctgcctttctaggctgcgggggacggcagagggcgcctcgccggttgcgcggcggaccatgcaggcctttcgcaaagcgctgatcgtaggcgcagtgctgggcgcgggggctggcgttggctccgcgctctttgtcctcgtgaccccgagagaggagcggattcaggcgatgctgaaggagatgccggggcaggacccgcggagcagggagcaggcggccaggaacaaacagttagtgctagctactctgcaggaggcagcggccacgcaggagaacttggcctggaggaagaaatggatgggcagcggcggcgggaggtcagcgtgacctgggacctgcccctgtgggcgctgggacctgccttcccgcgcaggagtcggaggcggcctttaaagaatggacctggcggggagtccgggtccggggagccgccgttccgctcaaaccctgcactgacggcgctttcacgttcgcatggcgggcccgcaccatcggatgctgccaattgaggaaatcaataaatcacgttcctccatcgagaatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]