LOCUS       XM_039860438             750 bp    mRNA    linear   MAM 16-DEC-2025
DEFINITION  PREDICTED: Pteropus medius ubiquinol-cytochrome c reductase complex
            assembly factor 3 (UQCC3), mRNA.
ACCESSION   XM_039860438
VERSION     XM_039860438.1
DBLINK      BioProject: PRJNA703023
KEYWORDS    RefSeq.
SOURCE      Pteropus medius (Indian flying fox)
  ORGANISM  Pteropus medius
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Chiroptera; Yinpterochiroptera;
            Pteropodoidea; Pteropodidae; Pteropodinae; Pteropus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024356248.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_902729225.1-RS_2025_12
            Annotation Pipeline         :: NCBI Eukaryotic Genome Annotation
                                           Pipeline (EGAP)
            Annotation Software Version :: 10.5
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/12/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..750
                     /organism="Pteropus medius"
                     /mol_type="mRNA"
                     /isolation_source="ENVO:00010625"
                     /db_xref="taxon:143291"
                     /chromosome="Unknown"
     gene            1..750
                     /gene="UQCC3"
                     /note="ubiquinol-cytochrome c reductase complex assembly
                     factor 3; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 104 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:120600850"
     CDS             149..532
                     /gene="UQCC3"
                     /codon_start=1
                     /product="ubiquinol-cytochrome-c reductase complex
                     assembly factor 3"
                     /protein_id="XP_039716372.1"
                     /db_xref="GeneID:120600850"
                     /translation="

MVSSVGRSGPCREAVRRGGCLSRLRGTAEGASPVARRTMQAFRKALIVGAVLGAGAGVGSALFVLVTPREERIQAMLKEMPGQDPRSREQAARNKQLVLATLQEAAATQENLAWRKKWMGSGGGRSA"

     misc_feature    263..523
                     /gene="UQCC3"
                     /note="Ubiquinol-cytochrome-c reductase complex assembly
                     factor 3; Region: UQCC3; pfam15141"
                     /db_xref="CDD:464526"
ORIGIN      

ttcacgacaatgggctccgtgctcggtcctccttgccaacacttccttgacatgctcaaccgtctcgtccaaatctagatataaaacgcaggtgctctagattccaaacgttccgcagattaggccctctctagcccttcccttctctatggtgtcctctgtgggtcgctctggcccgtgcagggaggcggtgagacgcggtggctgcctttctaggctgcgggggacggcagagggcgcctcgccggttgcgcggcggaccatgcaggcctttcgcaaagcgctgatcgtaggcgcagtgctgggcgcgggggctggcgttggctccgcgctctttgtcctcgtgaccccgagagaggagcggattcaggcgatgctgaaggagatgccggggcaggacccgcggagcagggagcaggcggccaggaacaaacagttagtgctagctactctgcaggaggcagcggccacgcaggagaacttggcctggaggaagaaatggatgggcagcggcggcgggaggtcagcgtgacctgggacctgcccctgtgggcgctgggacctgccttcccgcgcaggagtcggaggcggcctttaaagaatggacctggcggggagtccgggtccggggagccgccgttccgctcaaaccctgcactgacggcgctttcacgttcgcatggcgggcccgcaccatcggatgctgccaattgaggaaatcaataaatcacgttcctccatcgagaatga

//