GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-29 16:19:38, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_039147831             738 bp    mRNA    linear   PLN 27-JAN-2021
DEFINITION  PREDICTED: Hibiscus syriacus uncharacterized LOC120130626
            (LOC120130626), mRNA.
ACCESSION   XM_039147831
VERSION     XM_039147831.1
DBLINK      BioProject: PRJNA691360
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Hibiscus syriacus
  ORGANISM  Hibiscus syriacus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae;
            Hibiscus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024062775.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Hibiscus syriacus Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..738
                     /organism="Hibiscus syriacus"
                     /mol_type="mRNA"
                     /cultivar="Baekdansim"
                     /isolate="YM2019G1"
                     /db_xref="taxon:106335"
                     /chromosome="Unknown"
                     /tissue_type="leaf"
                     /country="South Korea"
     gene            1..738
                     /gene="LOC120130626"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:120130626"
     CDS             1..738
                     /gene="LOC120130626"
                     /codon_start=1
                     /product="uncharacterized protein LOC120130626"
                     /protein_id="XP_039003762.1"
                     /db_xref="GeneID:120130626"
                     /translation="
MDSFVFDNVKAEKAKAMKRYNRLRSLAKAFRFLELLLALLFLAWTFERLPFVVKISGEFILKLGGIVASPPFVFLVCNVIIVTVVAKSGIFSAVSNADSKIYEEITKIAENRSKSESQEEIVYQDQEIISEANANTLTCEEMEPESDSDSEMDNPRVYRRSKSETLPIRKTEEVVTKELRRSETEKSRKFENVDGELFPEDELSNEEFQRTIEDFIAKQLRFRREESMSIVLQCSNPEKIILPSQ"
     misc_feature    235..>642
                     /gene="LOC120130626"
                     /note="Putative pectinesterase/pectinesterase inhibitor;
                     Region: PLN02745"
                     /db_xref="CDD:178346"
ORIGIN      
atggattcgtttgttttcgataacgtgaaagcagagaaagccaaggcgatgaagaggtacaaccggcttcgaagcttagcaaaggcgtttcgtttcttggaattgctcttggctttgctgtttttggcgtggaccttcgagcgcctgcctttcgtcgtcaagatctccggtgagttcattttgaagctcggcgggatcgttgcaagtccgcccttcgttttcctcgtatgtaacgtcatcatcgtcactgtcgttgctaagtccggcattttctccgcagttagcaatgccgattccaaaatttacgaggaaatcaccaaaatcgctgagaatcgctccaaatcggagtctcaagaagagattgtgtatcaagaccaggagatcatctctgaagcaaacgcaaatactctcacatgcgaggaaatggagccggagtcggactccgattctgagatggataatccgagagtctatagaaggagtaagtcggagacgttgccgataagaaaaaccgaggaggtagtgacgaaggaactacgtcgatcggagacagaaaagtcccggaaatttgaaaacgtggacggtgaattgttcccggaagacgagttgagcaacgaagagtttcaacgaacgatcgaagattttatcgccaaacagctgaggtttcgccgagaagaatctatgtctattgttctccaatgttcaaatcctgaaaaaataattttaccttctcagtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]