2024-04-29 16:19:38, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039147831 738 bp mRNA linear PLN 27-JAN-2021 DEFINITION PREDICTED: Hibiscus syriacus uncharacterized LOC120130626 (LOC120130626), mRNA. ACCESSION XM_039147831 VERSION XM_039147831.1 DBLINK BioProject: PRJNA691360 KEYWORDS RefSeq; includes ab initio. SOURCE Hibiscus syriacus ORGANISM Hibiscus syriacus Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Hibiscus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024062775.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Hibiscus syriacus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..738 /organism="Hibiscus syriacus" /mol_type="mRNA" /cultivar="Baekdansim" /isolate="YM2019G1" /db_xref="taxon:106335" /chromosome="Unknown" /tissue_type="leaf" /country="South Korea" gene 1..738 /gene="LOC120130626" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:120130626" CDS 1..738 /gene="LOC120130626" /codon_start=1 /product="uncharacterized protein LOC120130626" /protein_id="XP_039003762.1" /db_xref="GeneID:120130626" /translation="
MDSFVFDNVKAEKAKAMKRYNRLRSLAKAFRFLELLLALLFLAWTFERLPFVVKISGEFILKLGGIVASPPFVFLVCNVIIVTVVAKSGIFSAVSNADSKIYEEITKIAENRSKSESQEEIVYQDQEIISEANANTLTCEEMEPESDSDSEMDNPRVYRRSKSETLPIRKTEEVVTKELRRSETEKSRKFENVDGELFPEDELSNEEFQRTIEDFIAKQLRFRREESMSIVLQCSNPEKIILPSQ"
misc_feature 235..>642 /gene="LOC120130626" /note="Putative pectinesterase/pectinesterase inhibitor; Region: PLN02745" /db_xref="CDD:178346" ORIGIN
atggattcgtttgttttcgataacgtgaaagcagagaaagccaaggcgatgaagaggtacaaccggcttcgaagcttagcaaaggcgtttcgtttcttggaattgctcttggctttgctgtttttggcgtggaccttcgagcgcctgcctttcgtcgtcaagatctccggtgagttcattttgaagctcggcgggatcgttgcaagtccgcccttcgttttcctcgtatgtaacgtcatcatcgtcactgtcgttgctaagtccggcattttctccgcagttagcaatgccgattccaaaatttacgaggaaatcaccaaaatcgctgagaatcgctccaaatcggagtctcaagaagagattgtgtatcaagaccaggagatcatctctgaagcaaacgcaaatactctcacatgcgaggaaatggagccggagtcggactccgattctgagatggataatccgagagtctatagaaggagtaagtcggagacgttgccgataagaaaaaccgaggaggtagtgacgaaggaactacgtcgatcggagacagaaaagtcccggaaatttgaaaacgtggacggtgaattgttcccggaagacgagttgagcaacgaagagtttcaacgaacgatcgaagattttatcgccaaacagctgaggtttcgccgagaagaatctatgtctattgttctccaatgttcaaatcctgaaaaaataattttaccttctcagtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]