ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-25 21:47:25, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_039147831 738 bp mRNA linear PLN 27-JAN-2021
DEFINITION PREDICTED: Hibiscus syriacus uncharacterized LOC120130626
(LOC120130626), mRNA.
ACCESSION XM_039147831
VERSION XM_039147831.1
DBLINK BioProject: PRJNA691360
KEYWORDS RefSeq; includes ab initio.
SOURCE Hibiscus syriacus
ORGANISM Hibiscus syriacus
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae;
Hibiscus.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_024062775.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Hibiscus syriacus Annotation Release
100
Annotation Version :: 100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 8.5
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 100% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..738
/organism="Hibiscus syriacus"
/mol_type="mRNA"
/cultivar="Baekdansim"
/isolate="YM2019G1"
/db_xref="taxon:106335"
/chromosome="Unknown"
/tissue_type="leaf"
/geo_loc_name="South Korea"
gene 1..738
/gene="LOC120130626"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 1 Protein"
/db_xref="GeneID:120130626"
CDS 1..738
/gene="LOC120130626"
/codon_start=1
/product="uncharacterized protein LOC120130626"
/protein_id="XP_039003762.1"
/db_xref="GeneID:120130626"
/translation="
MDSFVFDNVKAEKAKAMKRYNRLRSLAKAFRFLELLLALLFLAWTFERLPFVVKISGEFILKLGGIVASPPFVFLVCNVIIVTVVAKSGIFSAVSNADSKIYEEITKIAENRSKSESQEEIVYQDQEIISEANANTLTCEEMEPESDSDSEMDNPRVYRRSKSETLPIRKTEEVVTKELRRSETEKSRKFENVDGELFPEDELSNEEFQRTIEDFIAKQLRFRREESMSIVLQCSNPEKIILPSQ"
misc_feature 235..>642
/gene="LOC120130626"
/note="Putative pectinesterase/pectinesterase inhibitor;
Region: PLN02745"
/db_xref="CDD:178346"
ORIGIN
atggattcgtttgttttcgataacgtgaaagcagagaaagccaaggcgatgaagaggtacaaccggcttcgaagcttagcaaaggcgtttcgtttcttggaattgctcttggctttgctgtttttggcgtggaccttcgagcgcctgcctttcgtcgtcaagatctccggtgagttcattttgaagctcggcgggatcgttgcaagtccgcccttcgttttcctcgtatgtaacgtcatcatcgtcactgtcgttgctaagtccggcattttctccgcagttagcaatgccgattccaaaatttacgaggaaatcaccaaaatcgctgagaatcgctccaaatcggagtctcaagaagagattgtgtatcaagaccaggagatcatctctgaagcaaacgcaaatactctcacatgcgaggaaatggagccggagtcggactccgattctgagatggataatccgagagtctatagaaggagtaagtcggagacgttgccgataagaaaaaccgaggaggtagtgacgaaggaactacgtcgatcggagacagaaaagtcccggaaatttgaaaacgtggacggtgaattgttcccggaagacgagttgagcaacgaagagtttcaacgaacgatcgaagattttatcgccaaacagctgaggtttcgccgagaagaatctatgtctattgttctccaatgttcaaatcctgaaaaaataattttaccttctcagtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]